BLASTX nr result
ID: Glycyrrhiza36_contig00025615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00025615 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH48961.1 hypothetical protein GLYMA_07G1229001, partial [Glyci... 62 2e-11 KHN34010.1 hypothetical protein glysoja_033457 [Glycine soja] 62 3e-11 XP_016174759.1 PREDICTED: uncharacterized protein LOC107617506 i... 64 4e-10 XP_016174758.1 PREDICTED: uncharacterized protein LOC107617506 i... 64 4e-10 KYP75199.1 Retrotransposable element Tf2 [Cajanus cajan] 63 7e-10 KRH66333.1 hypothetical protein GLYMA_03G099600 [Glycine max] 62 1e-09 XP_014629150.1 PREDICTED: uncharacterized protein LOC100786119 i... 62 1e-09 XP_006583495.1 PREDICTED: uncharacterized protein LOC100807087 i... 62 1e-09 XP_006583494.1 PREDICTED: uncharacterized protein LOC100807087 i... 62 1e-09 KHM98981.1 hypothetical protein glysoja_044011 [Glycine soja] 62 1e-09 XP_014633444.1 PREDICTED: uncharacterized protein LOC100807087 i... 62 1e-09 XP_006583493.1 PREDICTED: uncharacterized protein LOC100807087 i... 62 1e-09 KZV22299.1 hypothetical protein F511_17901 [Dorcoceras hygrometr... 59 2e-09 XP_011093414.1 PREDICTED: uncharacterized protein LOC105173395 i... 61 2e-09 EEF38348.1 conserved hypothetical protein [Ricinus communis] 58 3e-09 GAU36316.1 hypothetical protein TSUD_353610 [Trifolium subterran... 60 5e-09 XP_004510167.1 PREDICTED: uncharacterized protein LOC101491622 i... 60 5e-09 XP_004510166.1 PREDICTED: uncharacterized protein LOC101491622 i... 60 5e-09 XP_013443976.1 hypothetical protein MTR_8g009780 [Medicago trunc... 60 5e-09 BAT96913.1 hypothetical protein VIGAN_09023200 [Vigna angularis ... 60 6e-09 >KRH48961.1 hypothetical protein GLYMA_07G1229001, partial [Glycine max] KRH48962.1 hypothetical protein GLYMA_07G1229001, partial [Glycine max] Length = 55 Score = 62.0 bits (149), Expect = 2e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >KHN34010.1 hypothetical protein glysoja_033457 [Glycine soja] Length = 72 Score = 62.0 bits (149), Expect = 3e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_016174759.1 PREDICTED: uncharacterized protein LOC107617506 isoform X2 [Arachis ipaensis] Length = 2154 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL YKVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPYKVKAMSRESPSQKALHVLDT 34 >XP_016174758.1 PREDICTED: uncharacterized protein LOC107617506 isoform X1 [Arachis ipaensis] Length = 2155 Score = 63.5 bits (153), Expect = 4e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL YKVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPYKVKAMSRESPSQKALHVLDT 34 >KYP75199.1 Retrotransposable element Tf2 [Cajanus cajan] Length = 1344 Score = 62.8 bits (151), Expect = 7e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL++KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALSFKVKAMSRESPSQKALHVLDT 34 >KRH66333.1 hypothetical protein GLYMA_03G099600 [Glycine max] Length = 405 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_014629150.1 PREDICTED: uncharacterized protein LOC100786119 isoform X1 [Glycine max] Length = 525 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_006583495.1 PREDICTED: uncharacterized protein LOC100807087 isoform X5 [Glycine max] Length = 1915 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_006583494.1 PREDICTED: uncharacterized protein LOC100807087 isoform X3 [Glycine max] Length = 2152 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >KHM98981.1 hypothetical protein glysoja_044011 [Glycine soja] Length = 2156 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_014633444.1 PREDICTED: uncharacterized protein LOC100807087 isoform X2 [Glycine max] Length = 2157 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >XP_006583493.1 PREDICTED: uncharacterized protein LOC100807087 isoform X1 [Glycine max] Length = 2160 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKAMSRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDT 34 >KZV22299.1 hypothetical protein F511_17901 [Dorcoceras hygrometricum] Length = 138 Score = 59.3 bits (142), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK L+YKVKAMSRESP+QKA +VLDT Sbjct: 1 MEVELEPRVKPLSYKVKAMSRESPAQKAAHVLDT 34 >XP_011093414.1 PREDICTED: uncharacterized protein LOC105173395 isoform X1 [Sesamum indicum] Length = 2174 Score = 61.2 bits (147), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK LAYKVKAMSRESP+QKA++VLDT Sbjct: 1 MEVELEPRVKQLAYKVKAMSRESPAQKAVHVLDT 34 >EEF38348.1 conserved hypothetical protein [Ricinus communis] Length = 109 Score = 57.8 bits (138), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 ME+ELEPRVK L+YKVK MSRESPSQKA ++LDT Sbjct: 1 MEIELEPRVKPLSYKVKGMSRESPSQKASHILDT 34 >GAU36316.1 hypothetical protein TSUD_353610 [Trifolium subterraneum] Length = 1921 Score = 60.5 bits (145), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK L +KVKAMSRESPSQKALNVLD+ Sbjct: 1 MEVELEPRVKPLQFKVKAMSRESPSQKALNVLDS 34 >XP_004510167.1 PREDICTED: uncharacterized protein LOC101491622 isoform X2 [Cicer arietinum] Length = 2150 Score = 60.5 bits (145), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK L +KVKAMSRESPSQKALNVLD+ Sbjct: 1 MEVELEPRVKPLPFKVKAMSRESPSQKALNVLDS 34 >XP_004510166.1 PREDICTED: uncharacterized protein LOC101491622 isoform X1 [Cicer arietinum] Length = 2151 Score = 60.5 bits (145), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK L +KVKAMSRESPSQKALNVLD+ Sbjct: 1 MEVELEPRVKPLPFKVKAMSRESPSQKALNVLDS 34 >XP_013443976.1 hypothetical protein MTR_8g009780 [Medicago truncatula] KEH18003.1 hypothetical protein MTR_8g009780 [Medicago truncatula] Length = 2158 Score = 60.5 bits (145), Expect = 5e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVK L +KVKAMSRESPSQKALNVLD+ Sbjct: 1 MEVELEPRVKPLQFKVKAMSRESPSQKALNVLDS 34 >BAT96913.1 hypothetical protein VIGAN_09023200 [Vigna angularis var. angularis] Length = 275 Score = 59.7 bits (143), Expect = 6e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 106 MEVELEPRVKALAYKVKAMSRESPSQKALNVLDT 207 MEVELEPRVKAL +KVKA SRESPSQKAL+VLDT Sbjct: 1 MEVELEPRVKALPFKVKATSRESPSQKALHVLDT 34