BLASTX nr result
ID: Glycyrrhiza36_contig00024449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024449 (222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU51253.1 hypothetical protein TSUD_412460, partial [Trifolium ... 57 9e-08 >GAU51253.1 hypothetical protein TSUD_412460, partial [Trifolium subterraneum] Length = 609 Score = 57.0 bits (136), Expect = 9e-08 Identities = 21/46 (45%), Positives = 31/46 (67%) Frame = -3 Query: 220 DFEWDAVWLTTCSALWRWLIQRVHNPDFVAPDWPWDSILHVLRSYR 83 D +WDAVW+TTC LW+W +RVH P+ + PW IL+++ Y+ Sbjct: 385 DLDWDAVWVTTCFWLWKWRNKRVHEPNHTSQWKPWSFILNLVNEYK 430