BLASTX nr result
ID: Glycyrrhiza36_contig00024217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024217 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013459913.1 disease resistance protein (CC-NBS-LRR class) fam... 57 8e-08 XP_013459911.1 disease resistance protein (CC-NBS-LRR class) fam... 57 8e-08 XP_013459912.1 disease resistance protein (CC-NBS-LRR class) fam... 57 8e-08 XP_003600185.2 disease resistance protein (CC-NBS-LRR class) fam... 57 8e-08 XP_004516857.1 PREDICTED: putative disease resistance protein At... 54 2e-06 GAU28746.1 hypothetical protein TSUD_372550 [Trifolium subterran... 52 9e-06 >XP_013459913.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] KEH33944.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 1031 Score = 57.4 bits (137), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVIK 235 +DI+I+ VAKV+EY++GP IREGKYFLC+ K+IK Sbjct: 2 ADIVITTVAKVSEYIIGPVIREGKYFLCVGKIIK 35 >XP_013459911.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] KEH33942.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 1237 Score = 57.4 bits (137), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVIK 235 +DI+I+ VAKV+EY++GP IREGKYFLC+ K+IK Sbjct: 2 ADIVITTVAKVSEYIIGPVIREGKYFLCVGKIIK 35 >XP_013459912.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] KEH33943.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 1262 Score = 57.4 bits (137), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVIK 235 +DI+I+ VAKV+EY++GP IREGKYFLC+ K+IK Sbjct: 2 ADIVITTVAKVSEYIIGPVIREGKYFLCVGKIIK 35 >XP_003600185.2 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] AES70436.2 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 1324 Score = 57.4 bits (137), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVIK 235 +DI+I+ VAKV+EY++GP IREGKYFLC+ K+IK Sbjct: 2 ADIVITTVAKVSEYIIGPVIREGKYFLCVGKIIK 35 >XP_004516857.1 PREDICTED: putative disease resistance protein At5g05400 [Cicer arietinum] Length = 1026 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVIK 235 +DI+ISIV KV+EYLV PAIREGKY C+N++++ Sbjct: 2 ADIVISIVTKVSEYLVEPAIREGKYIFCVNEIVE 35 >GAU28746.1 hypothetical protein TSUD_372550 [Trifolium subterraneum] Length = 774 Score = 51.6 bits (122), Expect = 9e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 SDIIISIVAKVAEYLVGPAIREGKYFLCINKVI 232 +D+ ISIVA + E LVGPAIREGK FLC+NKVI Sbjct: 2 ADVAISIVASLVERLVGPAIREGKCFLCVNKVI 34