BLASTX nr result
ID: Glycyrrhiza36_contig00024212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024212 (869 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007149786.1 hypothetical protein PHAVU_005G098700g [Phaseolus... 224 3e-68 KHN27922.1 Pentatricopeptide repeat-containing protein, partial ... 221 1e-67 XP_003540386.1 PREDICTED: pentatricopeptide repeat-containing pr... 221 5e-67 XP_014491746.1 PREDICTED: pentatricopeptide repeat-containing pr... 221 7e-67 KYP53336.1 Pentatricopeptide repeat-containing protein At1g06270... 218 9e-67 XP_017425076.1 PREDICTED: pentatricopeptide repeat-containing pr... 220 1e-66 XP_016171680.1 PREDICTED: pentatricopeptide repeat-containing pr... 219 2e-66 XP_016171679.1 PREDICTED: pentatricopeptide repeat-containing pr... 219 2e-66 XP_016171678.1 PREDICTED: pentatricopeptide repeat-containing pr... 219 6e-66 XP_013465185.1 PPR containing plant-like protein [Medicago trunc... 218 1e-65 XP_016171677.1 PREDICTED: pentatricopeptide repeat-containing pr... 219 1e-65 XP_004487183.1 PREDICTED: pentatricopeptide repeat-containing pr... 217 2e-65 XP_015936314.1 PREDICTED: pentatricopeptide repeat-containing pr... 215 1e-64 XP_015936311.1 PREDICTED: pentatricopeptide repeat-containing pr... 215 1e-64 KYP51819.1 Pentatricopeptide repeat-containing protein At1g06270... 213 1e-63 GAU27096.1 hypothetical protein TSUD_104050 [Trifolium subterran... 212 1e-63 OIW11977.1 hypothetical protein TanjilG_02184 [Lupinus angustifo... 212 2e-63 XP_019443349.1 PREDICTED: pentatricopeptide repeat-containing pr... 212 2e-63 GAU14076.1 hypothetical protein TSUD_169010 [Trifolium subterran... 209 3e-63 XP_013465186.1 papain family cysteine protease [Medicago truncat... 195 5e-57 >XP_007149786.1 hypothetical protein PHAVU_005G098700g [Phaseolus vulgaris] XP_007149787.1 hypothetical protein PHAVU_005G098700g [Phaseolus vulgaris] ESW21780.1 hypothetical protein PHAVU_005G098700g [Phaseolus vulgaris] ESW21781.1 hypothetical protein PHAVU_005G098700g [Phaseolus vulgaris] Length = 329 Score = 224 bits (570), Expect = 3e-68 Identities = 111/123 (90%), Positives = 117/123 (95%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEAQDLMKQMVV+YGLTPGQGTLVKL+AALRANREIW AVE+IEFLEKEGNSVGFESY Sbjct: 207 KTAEAQDLMKQMVVQYGLTPGQGTLVKLLAALRANREIWNAVEMIEFLEKEGNSVGFESY 266 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEKCEYVLA KVA GM ERGFIPYI+VRQKIIEGL SI+EWKIACAVRQRF A Sbjct: 267 ELVIEGCLEKCEYVLAAKVATGMAERGFIPYIRVRQKIIEGLVSINEWKIACAVRQRFTA 326 Query: 507 LKS 499 LKS Sbjct: 327 LKS 329 >KHN27922.1 Pentatricopeptide repeat-containing protein, partial [Glycine soja] Length = 295 Score = 221 bits (563), Expect = 1e-67 Identities = 111/123 (90%), Positives = 118/123 (95%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TA+A DLMKQMVV+YGLTPGQGTLVKL+AALRANREIWKAVE+IEFLEKEGNSVGFESY Sbjct: 173 KTAKALDLMKQMVVQYGLTPGQGTLVKLLAALRANREIWKAVEMIEFLEKEGNSVGFESY 232 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLA KVA GMTERGFIPYI+VRQKIIEGLASIDEW +ACAVRQRFAA Sbjct: 233 ELVIEGCLEKREYVLAAKVATGMTERGFIPYIRVRQKIIEGLASIDEWNLACAVRQRFAA 292 Query: 507 LKS 499 LKS Sbjct: 293 LKS 295 >XP_003540386.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Glycine max] XP_014620547.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Glycine max] KRH27010.1 hypothetical protein GLYMA_12G208100 [Glycine max] Length = 342 Score = 221 bits (563), Expect = 5e-67 Identities = 111/123 (90%), Positives = 118/123 (95%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TA+A DLMKQMVV+YGLTPGQGTLVKL+AALRANREIWKAVE+IEFLEKEGNSVGFESY Sbjct: 220 KTAKALDLMKQMVVQYGLTPGQGTLVKLLAALRANREIWKAVEMIEFLEKEGNSVGFESY 279 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLA KVA GMTERGFIPYI+VRQKIIEGLASIDEW +ACAVRQRFAA Sbjct: 280 ELVIEGCLEKREYVLAAKVATGMTERGFIPYIRVRQKIIEGLASIDEWNLACAVRQRFAA 339 Query: 507 LKS 499 LKS Sbjct: 340 LKS 342 >XP_014491746.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491747.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491748.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491749.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491750.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491751.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491752.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491753.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491754.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] XP_014491755.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna radiata var. radiata] Length = 343 Score = 221 bits (562), Expect = 7e-67 Identities = 109/123 (88%), Positives = 117/123 (95%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEAQDL+KQMVV+YGLTPGQG LVKL+AALRANREIW AVE+IEFLEK+GNSVGFESY Sbjct: 221 KTAEAQDLLKQMVVQYGLTPGQGILVKLLAALRANREIWNAVEIIEFLEKDGNSVGFESY 280 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEKCEYVLA KVA GMTERGFIPYI VRQKIIEGLASI+EWKIACA+R RFAA Sbjct: 281 ELVIEGCLEKCEYVLAAKVATGMTERGFIPYIAVRQKIIEGLASINEWKIACALRHRFAA 340 Query: 507 LKS 499 LKS Sbjct: 341 LKS 343 >KYP53336.1 Pentatricopeptide repeat-containing protein At1g06270 family [Cajanus cajan] Length = 259 Score = 218 bits (554), Expect = 9e-67 Identities = 110/123 (89%), Positives = 117/123 (95%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +T EA LM+QMVV+YGLTPGQGTLVKL+AALRANREIWKAVE+IEFLEKEGNSVGFESY Sbjct: 137 KTDEALVLMQQMVVQYGLTPGQGTLVKLLAALRANREIWKAVEMIEFLEKEGNSVGFESY 196 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLA KVA GMTERGFIPYI+VRQKII+GLASIDEWKIACAVRQRFAA Sbjct: 197 ELVIEGCLEKLEYVLAAKVATGMTERGFIPYIRVRQKIIDGLASIDEWKIACAVRQRFAA 256 Query: 507 LKS 499 LKS Sbjct: 257 LKS 259 >XP_017425076.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna angularis] XP_017425077.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vigna angularis] Length = 342 Score = 220 bits (561), Expect = 1e-66 Identities = 109/123 (88%), Positives = 116/123 (94%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEAQDL+KQMVV+YGLTPGQG LVKL+AALRANREIW AVE+IEFLEKEGNSVGFESY Sbjct: 220 KTAEAQDLLKQMVVQYGLTPGQGILVKLLAALRANREIWNAVEIIEFLEKEGNSVGFESY 279 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEKCEYVLA KVA GMTERGFIPYI VRQKIIEGL SI+EWKIACA+R RFAA Sbjct: 280 ELVIEGCLEKCEYVLAAKVATGMTERGFIPYIAVRQKIIEGLVSINEWKIACALRHRFAA 339 Query: 507 LKS 499 LKS Sbjct: 340 LKS 342 >XP_016171680.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X4 [Arachis ipaensis] Length = 337 Score = 219 bits (559), Expect = 2e-66 Identities = 111/123 (90%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SVGFESY Sbjct: 215 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEIIELLEKEGHSVGFESY 274 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 275 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKARQKIIEGLASIGEWKIACAVRQRFTS 334 Query: 507 LKS 499 LKS Sbjct: 335 LKS 337 >XP_016171679.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X3 [Arachis ipaensis] Length = 343 Score = 219 bits (559), Expect = 2e-66 Identities = 111/123 (90%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SVGFESY Sbjct: 221 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEIIELLEKEGHSVGFESY 280 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 281 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKARQKIIEGLASIGEWKIACAVRQRFTS 340 Query: 507 LKS 499 LKS Sbjct: 341 LKS 343 >XP_016171678.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X2 [Arachis ipaensis] Length = 380 Score = 219 bits (559), Expect = 6e-66 Identities = 111/123 (90%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SVGFESY Sbjct: 258 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEIIELLEKEGHSVGFESY 317 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 318 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKARQKIIEGLASIGEWKIACAVRQRFTS 377 Query: 507 LKS 499 LKS Sbjct: 378 LKS 380 >XP_013465185.1 PPR containing plant-like protein [Medicago truncatula] KEH39220.1 PPR containing plant-like protein [Medicago truncatula] Length = 354 Score = 218 bits (555), Expect = 1e-65 Identities = 106/123 (86%), Positives = 116/123 (94%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 RT++AQDLMKQMV KYGLTP GT+VK+++ALRAN+EIWKAVE+IEFLEKEGNSVGFESY Sbjct: 232 RTSDAQDLMKQMVAKYGLTPDHGTMVKILSALRANKEIWKAVEMIEFLEKEGNSVGFESY 291 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELV+EGCLE+ EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASIDEWKIAC VRQRFA Sbjct: 292 ELVVEGCLERREYVLAGKVAMGMTERGFIPYIKARQKIIEGLASIDEWKIACGVRQRFAT 351 Query: 507 LKS 499 LKS Sbjct: 352 LKS 354 >XP_016171677.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X1 [Arachis ipaensis] Length = 409 Score = 219 bits (559), Expect = 1e-65 Identities = 111/123 (90%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SVGFESY Sbjct: 287 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEIIELLEKEGHSVGFESY 346 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 347 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKARQKIIEGLASIGEWKIACAVRQRFTS 406 Query: 507 LKS 499 LKS Sbjct: 407 LKS 409 >XP_004487183.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Cicer arietinum] XP_004487184.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Cicer arietinum] Length = 338 Score = 217 bits (552), Expect = 2e-65 Identities = 108/123 (87%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 RTA+AQDLMKQMVVKYGLTP GT+VK++AALRAN+EIWKAVE+IEFLE EGNSVGFESY Sbjct: 216 RTADAQDLMKQMVVKYGLTPDHGTVVKVLAALRANKEIWKAVEIIEFLEIEGNSVGFESY 275 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 EL IEGCLE EYVLAGKVAMGMTERGFIPYIK RQKII+GLASIDEWKIACAVRQRFA Sbjct: 276 ELAIEGCLETREYVLAGKVAMGMTERGFIPYIKARQKIIDGLASIDEWKIACAVRQRFAT 335 Query: 507 LKS 499 LKS Sbjct: 336 LKS 338 >XP_015936314.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X2 [Arachis duranensis] Length = 337 Score = 215 bits (547), Expect = 1e-64 Identities = 110/123 (89%), Positives = 114/123 (92%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SV FESY Sbjct: 215 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEMIELLEKEGHSVEFESY 274 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 275 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKSRQKIIEGLASIGEWKIACAVRQRFTS 334 Query: 507 LKS 499 LKS Sbjct: 335 LKS 337 >XP_015936311.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X1 [Arachis duranensis] XP_015936312.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X1 [Arachis duranensis] XP_015936313.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 isoform X1 [Arachis duranensis] Length = 343 Score = 215 bits (547), Expect = 1e-64 Identities = 110/123 (89%), Positives = 114/123 (92%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +TAEA DLMKQMVVKYGLTPGQGTLVKL AALRANREIWKAVE+IE LEKEG+SV FESY Sbjct: 221 KTAEAVDLMKQMVVKYGLTPGQGTLVKLFAALRANREIWKAVEMIELLEKEGHSVEFESY 280 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 E VIEGCLEK EYVLAGKVAMGMTERGFIPYIK RQKIIEGLASI EWKIACAVRQRF + Sbjct: 281 EAVIEGCLEKHEYVLAGKVAMGMTERGFIPYIKSRQKIIEGLASIGEWKIACAVRQRFTS 340 Query: 507 LKS 499 LKS Sbjct: 341 LKS 343 >KYP51819.1 Pentatricopeptide repeat-containing protein At1g06270 family [Cajanus cajan] Length = 342 Score = 213 bits (541), Expect = 1e-63 Identities = 108/123 (87%), Positives = 116/123 (94%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +T EA LM+QMVV+YGLTPGQGTLVKL+AALRANREIWKAVE+IEFLEKEG+ VGFESY Sbjct: 220 KTDEALVLMQQMVVQYGLTPGQGTLVKLLAALRANREIWKAVEMIEFLEKEGSFVGFESY 279 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLA KVA GMTERGFIPYI+VRQKII+GLASIDEWKIACAVRQRFAA Sbjct: 280 ELVIEGCLEKREYVLAAKVATGMTERGFIPYIRVRQKIIDGLASIDEWKIACAVRQRFAA 339 Query: 507 LKS 499 LKS Sbjct: 340 LKS 342 >GAU27096.1 hypothetical protein TSUD_104050 [Trifolium subterraneum] Length = 343 Score = 212 bits (540), Expect = 1e-63 Identities = 105/123 (85%), Positives = 114/123 (92%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 RT++AQDLMKQMVVKYGLTP G +VKL+AALR N+EIWKAVE+IEFLEKEGNSVGFESY Sbjct: 221 RTSDAQDLMKQMVVKYGLTPDHGIVVKLLAALRTNKEIWKAVEMIEFLEKEGNSVGFESY 280 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELV+EGCL + EYVLAGKVAMGMTERGFIPYIK R KIIEGLASIDEWKIACAVR+RFA Sbjct: 281 ELVVEGCLARREYVLAGKVAMGMTERGFIPYIKARLKIIEGLASIDEWKIACAVRERFAK 340 Query: 507 LKS 499 LKS Sbjct: 341 LKS 343 >OIW11977.1 hypothetical protein TanjilG_02184 [Lupinus angustifolius] Length = 337 Score = 212 bits (539), Expect = 2e-63 Identities = 107/123 (86%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +T EA+DL+K MVVKYGLTPGQGTLVKL AALRANREIWKA E+IEFLEKEG+SVGFESY Sbjct: 215 KTIEAEDLVKTMVVKYGLTPGQGTLVKLFAALRANREIWKAAEMIEFLEKEGHSVGFESY 274 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLAGKVA+ MTERGFIPYIKVRQKIIEGLASI EW+IAC+VRQ FAA Sbjct: 275 ELVIEGCLEKREYVLAGKVAVRMTERGFIPYIKVRQKIIEGLASIGEWEIACSVRQSFAA 334 Query: 507 LKS 499 LKS Sbjct: 335 LKS 337 >XP_019443349.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Lupinus angustifolius] Length = 343 Score = 212 bits (539), Expect = 2e-63 Identities = 107/123 (86%), Positives = 115/123 (93%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 +T EA+DL+K MVVKYGLTPGQGTLVKL AALRANREIWKA E+IEFLEKEG+SVGFESY Sbjct: 221 KTIEAEDLVKTMVVKYGLTPGQGTLVKLFAALRANREIWKAAEMIEFLEKEGHSVGFESY 280 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELVIEGCLEK EYVLAGKVA+ MTERGFIPYIKVRQKIIEGLASI EW+IAC+VRQ FAA Sbjct: 281 ELVIEGCLEKREYVLAGKVAVRMTERGFIPYIKVRQKIIEGLASIGEWEIACSVRQSFAA 340 Query: 507 LKS 499 LKS Sbjct: 341 LKS 343 >GAU14076.1 hypothetical protein TSUD_169010 [Trifolium subterraneum] Length = 264 Score = 209 bits (531), Expect = 3e-63 Identities = 103/123 (83%), Positives = 113/123 (91%) Frame = -3 Query: 867 RTAEAQDLMKQMVVKYGLTPGQGTLVKLMAALRANREIWKAVEVIEFLEKEGNSVGFESY 688 RT++AQDLMKQMV KYGLTP GT+VKL+AALR N+EIWKAVE+IEFLEKEGNSVGFESY Sbjct: 142 RTSDAQDLMKQMVEKYGLTPDHGTVVKLLAALRTNKEIWKAVEMIEFLEKEGNSVGFESY 201 Query: 687 ELVIEGCLEKCEYVLAGKVAMGMTERGFIPYIKVRQKIIEGLASIDEWKIACAVRQRFAA 508 ELV+EGCL + EYVLAGKVAMGMTERGFIPYIK R KIIEGL SI+EWKIACAVR+RFA Sbjct: 202 ELVVEGCLARREYVLAGKVAMGMTERGFIPYIKARLKIIEGLVSINEWKIACAVRERFAK 261 Query: 507 LKS 499 LKS Sbjct: 262 LKS 264 >XP_013465186.1 papain family cysteine protease [Medicago truncatula] KEH39221.1 papain family cysteine protease [Medicago truncatula] Length = 338 Score = 195 bits (496), Expect = 5e-57 Identities = 87/102 (85%), Positives = 95/102 (93%) Frame = +3 Query: 3 ASNEKMLKFVVAHQPVSVATDAGGLPFRFYSKGIFSGICGKELNHGMTIVGYGEENGEKF 182 A NEKMLK VAHQPVS+ATDAGG F+FYSKGIFSG CGK LNHGMTIVGYGEENG+K+ Sbjct: 237 ARNEKMLKAAVAHQPVSIATDAGGYAFQFYSKGIFSGSCGKNLNHGMTIVGYGEENGDKY 296 Query: 183 WLVKNSWANDWGESGYVRMKRDTKDKDGTCGIAMEATFPIKH 308 W+VKNSWANDWGESGYVRMKRDTKDKDGTCGIAM+AT+P+KH Sbjct: 297 WIVKNSWANDWGESGYVRMKRDTKDKDGTCGIAMDATYPVKH 338