BLASTX nr result
ID: Glycyrrhiza36_contig00024193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024193 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM31307.1 hypothetical protein LR48_Vigan01g086200 [Vigna angul... 54 5e-06 KOM42503.1 hypothetical protein LR48_Vigan05g010700 [Vigna angul... 53 8e-06 >KOM31307.1 hypothetical protein LR48_Vigan01g086200 [Vigna angularis] Length = 207 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 103 APCLCH------SSTSGCHMSTSFRLVRPRTILYWERTGS 2 APC H SS GCHM TSFRLVRPRT YWER GS Sbjct: 25 APCFLHRRHSPPSSVPGCHMPTSFRLVRPRTTPYWERLGS 64 >KOM42503.1 hypothetical protein LR48_Vigan05g010700 [Vigna angularis] Length = 187 Score = 52.8 bits (125), Expect = 8e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 103 APCLCH------SSTSGCHMSTSFRLVRPRTILYWERTGS 2 APCL H S GCHM TSFRLVRPRT YWER GS Sbjct: 4 APCLLHRRHSPPSLVPGCHMPTSFRLVRPRTTPYWERLGS 43