BLASTX nr result
ID: Glycyrrhiza36_contig00024140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024140 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHL44987.1 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica] 55 1e-06 >AHL44987.1 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica] Length = 562 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = +3 Query: 57 SAVIVEVPHLSLHFRS---HSSAHTHTFIVAPSSLHIPVLYLSLLSLGITISPCQPAQFP 227 +A + +V LS RS H S + FI++P SLH+PVLY SLLSLGIT+SP P P Sbjct: 77 TAFLHQVDSLSSSIRSLYPHLSKNDVAFILSPPSLHVPVLYFSLLSLGITVSPANPLSSP 136