BLASTX nr result
ID: Glycyrrhiza36_contig00024134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024134 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007146597.1 hypothetical protein PHAVU_006G053700g [Phaseolus... 58 2e-07 XP_014518855.1 PREDICTED: vacuolar protein 8 [Vigna radiata var.... 58 2e-07 XP_017435065.1 PREDICTED: ankyrin and armadillo repeat-containin... 58 2e-07 XP_007146599.1 hypothetical protein PHAVU_006G053700g [Phaseolus... 58 2e-07 XP_003530785.1 PREDICTED: vacuolar protein 8 [Glycine max] KHM99... 56 1e-06 KYP38851.1 U-box domain-containing protein 4 [Cajanus cajan] 56 2e-06 >XP_007146597.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] XP_007146598.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] ESW18591.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] ESW18592.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] Length = 362 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLDHV 291 QNRL+HIRASNEHM RSLRR+SVEQL WN D V Sbjct: 330 QNRLVHIRASNEHMARSLRRMSVEQLTWNPDVV 362 >XP_014518855.1 PREDICTED: vacuolar protein 8 [Vigna radiata var. radiata] XP_014518857.1 PREDICTED: vacuolar protein 8 [Vigna radiata var. radiata] Length = 461 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLDHV 291 QNRL+HIRASNEHM RSLRR+SVEQL WN D V Sbjct: 429 QNRLVHIRASNEHMARSLRRMSVEQLTWNPDLV 461 >XP_017435065.1 PREDICTED: ankyrin and armadillo repeat-containing protein [Vigna angularis] XP_017435066.1 PREDICTED: ankyrin and armadillo repeat-containing protein [Vigna angularis] KOM52361.1 hypothetical protein LR48_Vigan09g102000 [Vigna angularis] BAT88536.1 hypothetical protein VIGAN_05205900 [Vigna angularis var. angularis] Length = 461 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLDHV 291 QNRL+HIRASNEHM RSLRR+SVEQL WN D V Sbjct: 429 QNRLVHIRASNEHMARSLRRMSVEQLTWNPDLV 461 >XP_007146599.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] ESW18593.1 hypothetical protein PHAVU_006G053700g [Phaseolus vulgaris] Length = 461 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLDHV 291 QNRL+HIRASNEHM RSLRR+SVEQL WN D V Sbjct: 429 QNRLVHIRASNEHMARSLRRMSVEQLTWNPDVV 461 >XP_003530785.1 PREDICTED: vacuolar protein 8 [Glycine max] KHM99484.1 U-box domain-containing protein 4 [Glycine soja] KRH46318.1 hypothetical protein GLYMA_08G326100 [Glycine max] Length = 461 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLD 297 QNRL HIRASNEHM RSLRR+SVEQL WN D Sbjct: 429 QNRLTHIRASNEHMARSLRRMSVEQLTWNPD 459 >KYP38851.1 U-box domain-containing protein 4 [Cajanus cajan] Length = 461 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 389 QNRLIHIRASNEHMTRSLRRVSVEQLVWNLDHV 291 QNRL+HIRASNEHM RSLR +SVEQL WN D V Sbjct: 429 QNRLVHIRASNEHMARSLRIISVEQLTWNPDLV 461