BLASTX nr result
ID: Glycyrrhiza36_contig00024085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024085 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 1e-36 KRH13925.1 hypothetical protein GLYMA_15G273200 [Glycine max] 137 1e-35 KHN07701.1 Pentatricopeptide repeat-containing protein, chloropl... 137 1e-35 XP_003545972.2 PREDICTED: pentatricopeptide repeat-containing pr... 137 1e-35 XP_007153023.1 hypothetical protein PHAVU_003G001300g [Phaseolus... 135 5e-35 XP_007025555.2 PREDICTED: pentatricopeptide repeat-containing pr... 135 5e-35 EOY28177.1 Tetratricopeptide repeat-like superfamily protein [Th... 135 5e-35 XP_016206287.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 7e-35 XP_007214178.1 hypothetical protein PRUPE_ppa019185mg [Prunus pe... 135 9e-35 XP_019453668.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 2e-34 XP_011651139.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 3e-34 XP_008225136.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 3e-34 GAU14842.1 hypothetical protein TSUD_50540 [Trifolium subterraneum] 131 4e-34 KYP69015.1 Pentatricopeptide repeat-containing protein At2g22070... 133 4e-34 XP_019239908.1 PREDICTED: putative pentatricopeptide repeat-cont... 133 4e-34 XP_016442131.1 PREDICTED: putative pentatricopeptide repeat-cont... 133 4e-34 XP_009797200.1 PREDICTED: putative pentatricopeptide repeat-cont... 133 4e-34 XP_009600826.1 PREDICTED: putative pentatricopeptide repeat-cont... 133 4e-34 XP_015072144.1 PREDICTED: putative pentatricopeptide repeat-cont... 133 4e-34 XP_004516023.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 4e-34 >XP_016494163.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494164.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494165.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] XP_016494166.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tabacum] Length = 246 Score = 133 bits (334), Expect = 1e-36 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 182 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 241 Query: 121 CGDYW 107 CGDYW Sbjct: 242 CGDYW 246 >KRH13925.1 hypothetical protein GLYMA_15G273200 [Glycine max] Length = 858 Score = 137 bits (346), Expect = 1e-35 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 794 LAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINRFHHFKDGSCS 853 Query: 121 CGDYW 107 CGDYW Sbjct: 854 CGDYW 858 >KHN07701.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 927 Score = 137 bits (346), Expect = 1e-35 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 863 LAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINRFHHFKDGSCS 922 Query: 121 CGDYW 107 CGDYW Sbjct: 923 CGDYW 927 >XP_003545972.2 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] XP_014623850.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Glycine max] Length = 930 Score = 137 bits (346), Expect = 1e-35 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG PIRVKKNLR+CVDCHTFFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 866 LAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREIIVRDINRFHHFKDGSCS 925 Query: 121 CGDYW 107 CGDYW Sbjct: 926 CGDYW 930 >XP_007153023.1 hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] ESW25017.1 hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] Length = 858 Score = 135 bits (341), Expect = 5e-35 Identities = 61/65 (93%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+CVDCH FFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 794 LAVAFGLIATPPGAPIRVKKNLRICVDCHIFFKFVCKIVSREIIVRDINRFHHFKDGSCS 853 Query: 121 CGDYW 107 CGDYW Sbjct: 854 CGDYW 858 >XP_007025555.2 PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Theobroma cacao] Length = 946 Score = 135 bits (341), Expect = 5e-35 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+SKIVSREIIVRDINR+HHFKDGSCS Sbjct: 882 LAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFISKIVSREIIVRDINRYHHFKDGSCS 941 Query: 121 CGDYW 107 CGDYW Sbjct: 942 CGDYW 946 >EOY28177.1 Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 946 Score = 135 bits (341), Expect = 5e-35 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+SKIVSREIIVRDINR+HHFKDGSCS Sbjct: 882 LAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFISKIVSREIIVRDINRYHHFKDGSCS 941 Query: 121 CGDYW 107 CGDYW Sbjct: 942 CGDYW 946 >XP_016206287.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Arachis ipaensis] Length = 912 Score = 135 bits (340), Expect = 7e-35 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIAT PG+PIRVKKNLRVCVDCHTFFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 848 LAVAFGLIATSPGAPIRVKKNLRVCVDCHTFFKFVCKIVSREIIVRDINRFHHFKDGSCS 907 Query: 121 CGDYW 107 CGDYW Sbjct: 908 CGDYW 912 >XP_007214178.1 hypothetical protein PRUPE_ppa019185mg [Prunus persica] ONI10516.1 hypothetical protein PRUPE_4G051600 [Prunus persica] Length = 858 Score = 135 bits (339), Expect = 9e-35 Identities = 61/65 (93%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+ KIVSREIIVRDINRFHHFKDGSCS Sbjct: 794 LAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINRFHHFKDGSCS 853 Query: 121 CGDYW 107 CGDYW Sbjct: 854 CGDYW 858 >XP_019453668.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Lupinus angustifolius] Length = 919 Score = 134 bits (337), Expect = 2e-34 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAF LIATPPG+PIRVKKNLRVCVDCH FFKFV KIVSREIIVRDINRFHHFKDGSCS Sbjct: 855 LAVAFALIATPPGAPIRVKKNLRVCVDCHAFFKFVCKIVSREIIVRDINRFHHFKDGSCS 914 Query: 121 CGDYW 107 CGDYW Sbjct: 915 CGDYW 919 >XP_011651139.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cucumis sativus] KGN57354.1 hypothetical protein Csa_3G180420 [Cucumis sativus] Length = 924 Score = 133 bits (335), Expect = 3e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLRVC+DCHT FKF+SK+ SREIIVRDINRFHHF+DGSCS Sbjct: 860 LAVAFGLIATPPGAPIRVKKNLRVCIDCHTAFKFISKVASREIIVRDINRFHHFRDGSCS 919 Query: 121 CGDYW 107 CGDYW Sbjct: 920 CGDYW 924 >XP_008225136.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Prunus mume] Length = 947 Score = 133 bits (335), Expect = 3e-34 Identities = 60/65 (92%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLRVCVDCHT FKF+ KIVSREIIVRDINRFHHFKDGSCS Sbjct: 883 LAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREIIVRDINRFHHFKDGSCS 942 Query: 121 CGDYW 107 CG+YW Sbjct: 943 CGEYW 947 >GAU14842.1 hypothetical protein TSUD_50540 [Trifolium subterraneum] Length = 496 Score = 131 bits (330), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRV KNLRVCVDCHTF KFV+KIVSR+I+VRDINRFHHFKDGSCS Sbjct: 432 LAVAFGLIATPPGAPIRVMKNLRVCVDCHTFLKFVAKIVSRQIVVRDINRFHHFKDGSCS 491 Query: 121 CGDYW 107 CGD+W Sbjct: 492 CGDFW 496 >KYP69015.1 Pentatricopeptide repeat-containing protein At2g22070 family [Cajanus cajan] Length = 828 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG PIRVKKNLR+CVDCHTFF+FV K+VSREIIVRDINR+HHFKDG+CS Sbjct: 764 LAVAFGLIATPPGVPIRVKKNLRICVDCHTFFRFVCKVVSREIIVRDINRYHHFKDGTCS 823 Query: 121 CGDYW 107 CGDYW Sbjct: 824 CGDYW 828 >XP_019239908.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239909.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239910.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239911.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239913.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] XP_019239914.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana attenuata] Length = 883 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 819 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 878 Query: 121 CGDYW 107 CGDYW Sbjct: 879 CGDYW 883 >XP_016442131.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442133.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442134.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] XP_016442135.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] Length = 883 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 819 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 878 Query: 121 CGDYW 107 CGDYW Sbjct: 879 CGDYW 883 >XP_009797200.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] XP_009797201.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] XP_009797202.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] XP_009797203.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] XP_009797205.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] Length = 883 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 819 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 878 Query: 121 CGDYW 107 CGDYW Sbjct: 879 CGDYW 883 >XP_009600826.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_009600828.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_009600829.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_009600830.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_018626339.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_018626340.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] XP_018626341.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] Length = 883 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 819 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 878 Query: 121 CGDYW 107 CGDYW Sbjct: 879 CGDYW 883 >XP_015072144.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum pennellii] XP_015072145.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum pennellii] XP_015072146.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum pennellii] XP_015072147.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum pennellii] XP_015072148.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum pennellii] Length = 914 Score = 133 bits (334), Expect = 4e-34 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGLIATPPG+PIRVKKNLR+C+DCHT FKF+ KIVSREII+RDINRFHHFKDGSCS Sbjct: 850 LAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREIIIRDINRFHHFKDGSCS 909 Query: 121 CGDYW 107 CGDYW Sbjct: 910 CGDYW 914 >XP_004516023.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cicer arietinum] Length = 925 Score = 133 bits (334), Expect = 4e-34 Identities = 60/65 (92%), Positives = 63/65 (96%) Frame = -1 Query: 301 LAVAFGLIATPPGSPIRVKKNLRVCVDCHTFFKFVSKIVSREIIVRDINRFHHFKDGSCS 122 LAVAFGL+ATP G+PIRVKKNLRVCVDCHTF KFVSKIVSR+IIVRDINRFHHFKDGSCS Sbjct: 861 LAVAFGLVATPHGAPIRVKKNLRVCVDCHTFLKFVSKIVSRQIIVRDINRFHHFKDGSCS 920 Query: 121 CGDYW 107 CGDYW Sbjct: 921 CGDYW 925