BLASTX nr result
ID: Glycyrrhiza36_contig00024064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024064 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU33333.1 hypothetical protein TSUD_165980 [Trifolium subterran... 63 6e-10 XP_019449693.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-09 XP_012569571.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_012569570.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_012569569.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_012569568.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_004494545.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 XP_013467830.1 PPR containing plant protein [Medicago truncatula... 57 1e-07 XP_012567224.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 1e-06 >GAU33333.1 hypothetical protein TSUD_165980 [Trifolium subterraneum] Length = 501 Score = 63.2 bits (152), Expect = 6e-10 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +1 Query: 94 MQSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 MQSIYRA+VRDPSCI C L SR LFSSLA+CH A RD H Sbjct: 1 MQSIYRAVVRDPSCIFCLPLASRTLFSSLATCHDAEGRDFRH 42 >XP_019449693.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Lupinus angustifolius] XP_019449702.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Lupinus angustifolius] XP_019449710.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Lupinus angustifolius] OIW18840.1 hypothetical protein TanjilG_25283 [Lupinus angustifolius] Length = 501 Score = 62.0 bits (149), Expect = 1e-09 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +1 Query: 94 MQSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 MQSIYRAI+ SCICC+AL SRN SSLASC G R SWH Sbjct: 1 MQSIYRAILWGSSCICCKALASRNFCSSLASCDLVGTRGSWH 42 >XP_012569571.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X5 [Cicer arietinum] Length = 407 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +SIYRA+VRDPSCIC SR LFSSL++CH A AR+ WH Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWH 54 >XP_012569570.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X4 [Cicer arietinum] Length = 441 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +SIYRA+VRDPSCIC SR LFSSL++CH A AR+ WH Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWH 54 >XP_012569569.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X3 [Cicer arietinum] Length = 458 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +SIYRA+VRDPSCIC SR LFSSL++CH A AR+ WH Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWH 54 >XP_012569568.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X2 [Cicer arietinum] Length = 486 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +SIYRA+VRDPSCIC SR LFSSL++CH A AR+ WH Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWH 54 >XP_004494545.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Cicer arietinum] XP_004494546.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Cicer arietinum] Length = 513 Score = 61.2 bits (147), Expect = 3e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +SIYRA+VRDPSCIC SR LFSSL++CH A AR+ WH Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWH 54 >XP_013467830.1 PPR containing plant protein [Medicago truncatula] KEH41867.1 PPR containing plant protein [Medicago truncatula] Length = 501 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +1 Query: 94 MQSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 M+SIYR +VRD IC ALVSR LFSSLA+ H A ARD WH Sbjct: 1 MRSIYRLVVRDRFGICTMALVSRTLFSSLATYHAAEARDFWH 42 >XP_012567224.1 PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Cicer arietinum] Length = 480 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 97 QSIYRAIVRDPSCICCQALVSRNLFSSLASCHPAGARDSWH 219 +S YR +VRDPSCIC SR LFSSL++C A AR+ WH Sbjct: 12 KSKYRGVVRDPSCICYLVYSSRTLFSSLSNCRHAEAREFWH 52