BLASTX nr result
ID: Glycyrrhiza36_contig00024051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00024051 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019462624.1 PREDICTED: E3 ubiquitin-protein ligase RING1-like... 64 3e-10 XP_019462623.1 PREDICTED: RING-H2 finger protein ATL54-like isof... 64 3e-10 KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] 54 9e-07 XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Gly... 54 1e-06 >XP_019462624.1 PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 [Lupinus angustifolius] Length = 379 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 132 HHTHLLQIALIITACMVSMVMLLCTFSIILRSYYSRRHIHNHN 4 +H HLLQ+ALI+ ACMV MVM LC S+ILR YYSRR HN+N Sbjct: 54 NHVHLLQVALIVMACMVGMVMSLCIISLILRHYYSRRLNHNNN 96 >XP_019462623.1 PREDICTED: RING-H2 finger protein ATL54-like isoform X1 [Lupinus angustifolius] OIW00393.1 hypothetical protein TanjilG_05743 [Lupinus angustifolius] Length = 395 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 132 HHTHLLQIALIITACMVSMVMLLCTFSIILRSYYSRRHIHNHN 4 +H HLLQ+ALI+ ACMV MVM LC S+ILR YYSRR HN+N Sbjct: 54 NHVHLLQVALIVMACMVGMVMSLCIISLILRHYYSRRLNHNNN 96 >KRH59281.1 hypothetical protein GLYMA_05G175400 [Glycine max] Length = 339 Score = 53.9 bits (128), Expect = 9e-07 Identities = 21/50 (42%), Positives = 37/50 (74%) Frame = -1 Query: 150 MPSPEIHHTHLLQIALIITACMVSMVMLLCTFSIILRSYYSRRHIHNHNH 1 +PS + HH ++ Q+A+I+ ACMV ++M LC S+++R +YSRR+ N+ + Sbjct: 37 IPSFKEHHKNVPQLAMIVMACMVGVIMFLCAVSVLIRYFYSRRYSRNNQN 86 >XP_006580255.1 PREDICTED: RING-H2 finger protein ATL52-like [Glycine max] Length = 364 Score = 53.9 bits (128), Expect = 1e-06 Identities = 21/50 (42%), Positives = 37/50 (74%) Frame = -1 Query: 150 MPSPEIHHTHLLQIALIITACMVSMVMLLCTFSIILRSYYSRRHIHNHNH 1 +PS + HH ++ Q+A+I+ ACMV ++M LC S+++R +YSRR+ N+ + Sbjct: 37 IPSFKEHHKNVPQLAMIVMACMVGVIMFLCAVSVLIRYFYSRRYSRNNQN 86