BLASTX nr result
ID: Glycyrrhiza36_contig00023977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023977 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP76121.1 hypothetical protein KK1_020346 [Cajanus cajan] 164 6e-46 GAU21563.1 hypothetical protein TSUD_35260 [Trifolium subterraneum] 162 4e-45 XP_004495618.1 PREDICTED: pentatricopeptide repeat-containing pr... 159 2e-43 BAT95169.1 hypothetical protein VIGAN_08184100, partial [Vigna a... 150 1e-42 XP_003555175.2 PREDICTED: putative pentatricopeptide repeat-cont... 155 2e-42 XP_014628434.1 PREDICTED: putative pentatricopeptide repeat-cont... 155 4e-42 BAT95164.1 hypothetical protein VIGAN_08183600 [Vigna angularis ... 150 1e-40 XP_014510904.1 PREDICTED: putative pentatricopeptide repeat-cont... 149 7e-40 XP_013469087.1 pentatricopeptide (PPR) repeat protein [Medicago ... 148 1e-39 XP_007145038.1 hypothetical protein PHAVU_007G204600g [Phaseolus... 141 4e-37 KHN16024.1 Pentatricopeptide repeat-containing protein, chloropl... 135 2e-36 XP_016205634.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 6e-35 XP_015968720.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 6e-35 XP_019419863.1 PREDICTED: pentatricopeptide repeat-containing pr... 132 5e-34 XP_011466224.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 1e-28 XP_007208344.1 hypothetical protein PRUPE_ppa002033mg [Prunus pe... 112 6e-27 ONI04149.1 hypothetical protein PRUPE_6G305500 [Prunus persica] ... 112 6e-27 XP_008246311.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-26 XP_011023874.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 3e-26 XP_002318926.1 hypothetical protein POPTR_0013s00430g [Populus t... 109 8e-26 >KYP76121.1 hypothetical protein KK1_020346 [Cajanus cajan] Length = 572 Score = 164 bits (414), Expect = 6e-46 Identities = 76/93 (81%), Positives = 85/93 (91%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSFIY V++QC CKNLQLDSA+ LINEMI SG+PPKH+V VDMINCFCELGK+D+A+M Sbjct: 149 VPDSFIYEVIVQCFCKNLQLDSAVDLINEMIESGLPPKHNVLVDMINCFCELGKIDEAVM 208 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLED QVHE APFNTLLE CC+AGKILVANVLL Sbjct: 209 FLEDTQVHETAPFNTLLEGCCSAGKILVANVLL 241 >GAU21563.1 hypothetical protein TSUD_35260 [Trifolium subterraneum] Length = 604 Score = 162 bits (409), Expect = 4e-45 Identities = 75/93 (80%), Positives = 82/93 (88%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSF+YG LIQCLCKNLQLDSALCLINEMIG+GI P +VFV MINC+CELGK+D+AI Sbjct: 184 VPDSFVYGALIQCLCKNLQLDSALCLINEMIGNGIQPCENVFVHMINCYCELGKIDEAIT 243 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDK VHE APFN LLE CCNAGK+LVAN LL Sbjct: 244 FLEDKHVHETAPFNALLEGCCNAGKVLVANALL 276 >XP_004495618.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] XP_004495619.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] XP_012569876.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Cicer arietinum] Length = 717 Score = 159 bits (401), Expect = 2e-43 Identities = 74/93 (79%), Positives = 84/93 (90%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSFIY VLIQCLCKNL LDSAL L+NEMIGSGI PKH+VFV MI+C+CELGK+D+A+ Sbjct: 298 VPDSFIYEVLIQCLCKNLLLDSALYLVNEMIGSGISPKHNVFVHMIDCYCELGKIDEAVK 357 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLE+KQVHE APFN LLE CCNAGKI+VANV+L Sbjct: 358 FLEEKQVHETAPFNVLLEGCCNAGKIVVANVML 390 >BAT95169.1 hypothetical protein VIGAN_08184100, partial [Vigna angularis var. angularis] Length = 345 Score = 150 bits (379), Expect = 1e-42 Identities = 69/92 (75%), Positives = 81/92 (88%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PDSFIY VL++C C NLQLDSA+ LINEMI SG+PPKH V VD++NCFCELGK+ +AI+F Sbjct: 9 PDSFIYEVLVRCFCNNLQLDSAVALINEMIESGMPPKHYVLVDIMNCFCELGKIKEAIVF 68 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LE++QVHE APFNTLLE CCNAG+IL ANVLL Sbjct: 69 LENRQVHETAPFNTLLEGCCNAGEILAANVLL 100 >XP_003555175.2 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] XP_014628436.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] XP_014628437.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] XP_014628438.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] XP_014628439.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] XP_014628440.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X2 [Glycine max] Length = 620 Score = 155 bits (391), Expect = 2e-42 Identities = 71/93 (76%), Positives = 82/93 (88%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSFIY VL++C C NLQLDSA+ LINEMI G+PPKH+V VDM+NCFCELGK+++AIM Sbjct: 198 VPDSFIYEVLVRCFCNNLQLDSAVSLINEMIEIGMPPKHNVLVDMMNCFCELGKINEAIM 257 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLED QVHE APFNTLLE CCNAG++L ANVLL Sbjct: 258 FLEDTQVHETAPFNTLLEGCCNAGEVLAANVLL 290 >XP_014628434.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X1 [Glycine max] XP_014628435.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial isoform X1 [Glycine max] KRG90455.1 hypothetical protein GLYMA_20G092100 [Glycine max] Length = 720 Score = 155 bits (391), Expect = 4e-42 Identities = 71/93 (76%), Positives = 82/93 (88%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSFIY VL++C C NLQLDSA+ LINEMI G+PPKH+V VDM+NCFCELGK+++AIM Sbjct: 298 VPDSFIYEVLVRCFCNNLQLDSAVSLINEMIEIGMPPKHNVLVDMMNCFCELGKINEAIM 357 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLED QVHE APFNTLLE CCNAG++L ANVLL Sbjct: 358 FLEDTQVHETAPFNTLLEGCCNAGEVLAANVLL 390 >BAT95164.1 hypothetical protein VIGAN_08183600 [Vigna angularis var. angularis] Length = 621 Score = 150 bits (379), Expect = 1e-40 Identities = 69/92 (75%), Positives = 81/92 (88%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PDSFIY VL++C C NLQLDSA+ LINEMI SG+PPKH V VD++NCFCELGK+ +AI+F Sbjct: 199 PDSFIYEVLVRCFCNNLQLDSAVALINEMIESGMPPKHYVLVDIMNCFCELGKIKEAIVF 258 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LE++QVHE APFNTLLE CCNAG+IL ANVLL Sbjct: 259 LENRQVHETAPFNTLLEGCCNAGEILAANVLL 290 >XP_014510904.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial [Vigna radiata var. radiata] Length = 721 Score = 149 bits (375), Expect = 7e-40 Identities = 68/92 (73%), Positives = 80/92 (86%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PDSFIY VL++C C NLQLDSA+ LINEM+ SG+PPKH V VD++NCFCELGK+ +AI+F Sbjct: 299 PDSFIYEVLVRCFCNNLQLDSAVALINEMMESGMPPKHYVLVDIMNCFCELGKIKEAIVF 358 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LE +QVHE APFNTLLE CCNAG+IL ANVLL Sbjct: 359 LESRQVHETAPFNTLLEGCCNAGEILAANVLL 390 >XP_013469087.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH43125.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 724 Score = 148 bits (373), Expect = 1e-39 Identities = 72/93 (77%), Positives = 80/93 (86%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VP++ IY LIQCLCKNL+LDSA+ LINEMI SGI P +VFV MINC+CELGK+D+AIM Sbjct: 303 VPEALIYEALIQCLCKNLKLDSAVNLINEMIESGILPNENVFVHMINCYCELGKIDEAIM 362 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDKQV E APFN LLE CCNAGKILVANVLL Sbjct: 363 FLEDKQVSETAPFNVLLEGCCNAGKILVANVLL 395 >XP_007145038.1 hypothetical protein PHAVU_007G204600g [Phaseolus vulgaris] ESW17032.1 hypothetical protein PHAVU_007G204600g [Phaseolus vulgaris] Length = 721 Score = 141 bits (355), Expect = 4e-37 Identities = 66/93 (70%), Positives = 80/93 (86%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 V D FIY VL++C C NLQLDSA+ LINEMI SG+PPKH V V+++NCFCELGK+++AI+ Sbjct: 298 VADPFIYEVLVRCFCSNLQLDSAVGLINEMIESGMPPKHYVLVNIVNCFCELGKINEAIV 357 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLE++QV E APFNTLLE CCNAG+IL ANVLL Sbjct: 358 FLENRQVLETAPFNTLLEGCCNAGEILAANVLL 390 >KHN16024.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 391 Score = 135 bits (340), Expect = 2e-36 Identities = 63/83 (75%), Positives = 71/83 (85%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 VPDSFI VL+ C C NL+LDSA+ LINEMI SG+PPKHDV VDM+NC CELGK+++AIM Sbjct: 107 VPDSFICKVLVWCFCNNLRLDSAVGLINEMIESGMPPKHDVLVDMMNCSCELGKINEAIM 166 Query: 100 FLEDKQVHEAAPFNTLLERCCNA 32 FLED QVHE APFNTLLE CCNA Sbjct: 167 FLEDTQVHETAPFNTLLEGCCNA 189 >XP_016205634.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Arachis ipaensis] Length = 729 Score = 135 bits (339), Expect = 6e-35 Identities = 64/92 (69%), Positives = 73/92 (79%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PDS IYG L++CLC+NL LDSA+CLIN MI S I P D FVD++NCFCELGK+ +AIMF Sbjct: 305 PDSLIYGDLVRCLCRNLHLDSAICLINGMIESDISPSDDDFVDLVNCFCELGKVSEAIMF 364 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LEDKQV E AP+N LLE CCNAG IL A LL Sbjct: 365 LEDKQVLETAPYNALLEGCCNAGNILDAYFLL 396 >XP_015968720.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis duranensis] Length = 729 Score = 135 bits (339), Expect = 6e-35 Identities = 64/92 (69%), Positives = 73/92 (79%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PDS IYG L++CLC+NL LDSA+CLIN MI S I P D FVD++NCFCELGK+ +AIMF Sbjct: 305 PDSLIYGDLVRCLCRNLHLDSAICLINGMIESDISPSDDDFVDLVNCFCELGKVSEAIMF 364 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LEDKQV E AP+N LLE CCNAG IL A LL Sbjct: 365 LEDKQVLETAPYNALLEGCCNAGNILDAYFLL 396 >XP_019419863.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Lupinus angustifolius] OIV95318.1 hypothetical protein TanjilG_07474 [Lupinus angustifolius] Length = 727 Score = 132 bits (332), Expect = 5e-34 Identities = 60/93 (64%), Positives = 77/93 (82%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 +PDS IY VL++CLCKNL+LDSA+ L+NEMI SGI P +VFVD+++C+CELGK+++AIM Sbjct: 302 LPDSLIYSVLVECLCKNLRLDSAISLVNEMIESGIQPTDNVFVDLVDCYCELGKVNEAIM 361 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLED QV + A +N LLE CCNAGKI A +LL Sbjct: 362 FLEDNQVSDTASYNVLLEGCCNAGKIPEAYILL 394 >XP_011466224.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Fragaria vesca subsp. vesca] XP_011466225.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Fragaria vesca subsp. vesca] Length = 728 Score = 117 bits (293), Expect = 1e-28 Identities = 53/93 (56%), Positives = 70/93 (75%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 +PDS IYGVL+QCLCKNL LD ++ ++ +MI +G+ P VFVD++N FC LGK+DDA+ Sbjct: 303 MPDSRIYGVLLQCLCKNLYLDDSIKVLEDMIETGLTPPSHVFVDVMNVFCTLGKIDDALK 362 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDK + E + +N LLE CCN GKI +A LL Sbjct: 363 FLEDKHILETSAYNVLLEGCCNTGKITIAKDLL 395 >XP_007208344.1 hypothetical protein PRUPE_ppa002033mg [Prunus persica] Length = 725 Score = 112 bits (280), Expect = 6e-27 Identities = 51/93 (54%), Positives = 71/93 (76%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 +PDS I GVL+QCLCKNL L+ A+ ++ +M+ +G+ P +DVF D++N FC+LGK+DDA+ Sbjct: 300 MPDSLICGVLLQCLCKNLCLNDAIKVLEDMMETGLTPANDVFADVVNVFCKLGKIDDAMK 359 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDK + E + N LLE CC+AGK L+A LL Sbjct: 360 FLEDKHILETSVCNVLLEGCCSAGKFLMAKDLL 392 >ONI04149.1 hypothetical protein PRUPE_6G305500 [Prunus persica] ONI04150.1 hypothetical protein PRUPE_6G305500 [Prunus persica] Length = 728 Score = 112 bits (280), Expect = 6e-27 Identities = 51/93 (54%), Positives = 71/93 (76%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 +PDS I GVL+QCLCKNL L+ A+ ++ +M+ +G+ P +DVF D++N FC+LGK+DDA+ Sbjct: 303 MPDSLICGVLLQCLCKNLCLNDAIKVLEDMMETGLTPANDVFADVVNVFCKLGKIDDAMK 362 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDK + E + N LLE CC+AGK L+A LL Sbjct: 363 FLEDKHILETSVCNVLLEGCCSAGKFLMAKDLL 395 >XP_008246311.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63130, mitochondrial-like [Prunus mume] Length = 728 Score = 111 bits (277), Expect = 2e-26 Identities = 50/93 (53%), Positives = 70/93 (75%) Frame = -1 Query: 280 VPDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIM 101 +PDS I GVL+QCLCKNL L+ A+ ++ +M+ +G+ P +D F D++N FC+LGK+DDA+ Sbjct: 303 MPDSLICGVLLQCLCKNLCLNDAIKVLEDMMETGLTPANDAFADVVNVFCKLGKIDDAMK 362 Query: 100 FLEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 FLEDK + E + N LLE CC+AGK L+A LL Sbjct: 363 FLEDKHILETSACNVLLEGCCSAGKFLMAKDLL 395 >XP_011023874.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Populus euphratica] Length = 724 Score = 110 bits (275), Expect = 3e-26 Identities = 51/92 (55%), Positives = 68/92 (73%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PD FIYG LIQCLCK+L+LD A+ L+ EM+ S + P ++VFVD++N FC+LGK+++AI Sbjct: 301 PDPFIYGALIQCLCKHLRLDEAVYLLEEMMESRLTPDNNVFVDIVNGFCKLGKINEAIKL 360 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LEDK VH +P N LL CC+A K +A LL Sbjct: 361 LEDKHVHVTSPHNALLRCCCDADKFFMAKGLL 392 >XP_002318926.1 hypothetical protein POPTR_0013s00430g [Populus trichocarpa] EEE94849.1 hypothetical protein POPTR_0013s00430g [Populus trichocarpa] Length = 724 Score = 109 bits (272), Expect = 8e-26 Identities = 51/92 (55%), Positives = 67/92 (72%) Frame = -1 Query: 277 PDSFIYGVLIQCLCKNLQLDSALCLINEMIGSGIPPKHDVFVDMINCFCELGKLDDAIMF 98 PD FIYG LIQCLCK+L+LD A L+ EM+ S + P ++VFVD++N FC+LGK+++AI Sbjct: 301 PDPFIYGALIQCLCKHLRLDEAANLLEEMMESRLTPDNNVFVDIVNGFCKLGKINEAIKL 360 Query: 97 LEDKQVHEAAPFNTLLERCCNAGKILVANVLL 2 LEDK VH +P N LL CC+A K +A LL Sbjct: 361 LEDKHVHVTSPHNALLRCCCDADKFFMAKGLL 392