BLASTX nr result
ID: Glycyrrhiza36_contig00023813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023813 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU51177.1 hypothetical protein TSUD_181870 [Trifolium subterran... 72 1e-12 KHN40468.1 Putative pentatricopeptide repeat-containing protein ... 72 2e-12 XP_006602844.1 PREDICTED: putative pentatricopeptide repeat-cont... 72 2e-12 XP_004492833.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 6e-12 XP_016196100.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 8e-12 XP_015961939.1 PREDICTED: putative pentatricopeptide repeat-cont... 70 8e-12 KYP64156.1 Putative pentatricopeptide repeat-containing protein ... 69 1e-11 KHN29274.1 Putative pentatricopeptide repeat-containing protein ... 69 2e-11 KRH40310.1 hypothetical protein GLYMA_09G251000 [Glycine max] 69 2e-11 XP_006587808.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 XP_003624159.1 pentatricopeptide (PPR) repeat protein [Medicago ... 68 3e-11 XP_007208039.1 hypothetical protein PRUPE_ppa002768mg [Prunus pe... 68 4e-11 XP_011466069.1 PREDICTED: putative pentatricopeptide repeat-cont... 68 4e-11 ONI05188.1 hypothetical protein PRUPE_6G360800 [Prunus persica] 68 4e-11 XP_019431235.1 PREDICTED: putative pentatricopeptide repeat-cont... 67 5e-11 XP_016690564.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 7e-11 XP_012476888.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 7e-11 CBI17644.3 unnamed protein product, partial [Vitis vinifera] 64 6e-10 XP_010111070.1 hypothetical protein L484_015125 [Morus notabilis... 64 6e-10 XP_014496638.1 PREDICTED: putative pentatricopeptide repeat-cont... 64 6e-10 >GAU51177.1 hypothetical protein TSUD_181870 [Trifolium subterraneum] Length = 376 Score = 72.0 bits (175), Expect = 1e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLLER+IIVRDTHRFHHFK GSCSCGDYW Sbjct: 345 YASQLLEREIIVRDTHRFHHFKQGSCSCGDYW 376 >KHN40468.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 756 Score = 71.6 bits (174), Expect = 2e-12 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL+R+IIVRD HRFHHFKHGSCSCGDYW Sbjct: 725 YASQLLDREIIVRDIHRFHHFKHGSCSCGDYW 756 >XP_006602844.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Glycine max] KRH00914.1 hypothetical protein GLYMA_18G241500 [Glycine max] Length = 756 Score = 71.6 bits (174), Expect = 2e-12 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL+R+IIVRD HRFHHFKHGSCSCGDYW Sbjct: 725 YASQLLDREIIVRDIHRFHHFKHGSCSCGDYW 756 >XP_004492833.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Cicer arietinum] Length = 755 Score = 70.1 bits (170), Expect = 6e-12 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YAS LLER+IIVRDTHRFHHFK GSCSCGDYW Sbjct: 724 YASHLLEREIIVRDTHRFHHFKQGSCSCGDYW 755 >XP_016196100.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Arachis ipaensis] Length = 1050 Score = 69.7 bits (169), Expect = 8e-12 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLLER+IIVRD HRFHHF+HG CSCGDYW Sbjct: 1019 YASQLLEREIIVRDIHRFHHFRHGHCSCGDYW 1050 >XP_015961939.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Arachis duranensis] Length = 1050 Score = 69.7 bits (169), Expect = 8e-12 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLLER+IIVRD HRFHHF+HG CSCGDYW Sbjct: 1019 YASQLLEREIIVRDIHRFHHFRHGHCSCGDYW 1050 >KYP64156.1 Putative pentatricopeptide repeat-containing protein At3g23330 family [Cajanus cajan] Length = 613 Score = 68.9 bits (167), Expect = 1e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 5 ASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 ASQLL+R+IIVRD HRFHHFKHGSCSCGDYW Sbjct: 583 ASQLLDREIIVRDIHRFHHFKHGSCSCGDYW 613 >KHN29274.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 672 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL+R+II+RD HRFHHFKHG CSCGDYW Sbjct: 641 YASQLLDREIILRDIHRFHHFKHGGCSCGDYW 672 >KRH40310.1 hypothetical protein GLYMA_09G251000 [Glycine max] Length = 721 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL+R+II+RD HRFHHFKHG CSCGDYW Sbjct: 690 YASQLLDREIILRDIHRFHHFKHGGCSCGDYW 721 >XP_006587808.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Glycine max] Length = 771 Score = 68.9 bits (167), Expect = 2e-11 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL+R+II+RD HRFHHFKHG CSCGDYW Sbjct: 740 YASQLLDREIILRDIHRFHHFKHGGCSCGDYW 771 >XP_003624159.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] ABD28372.1 Tetratricopeptide-like helical [Medicago truncatula] AES80377.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 755 Score = 68.2 bits (165), Expect = 3e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLLER+IIVRDTHRFHHFK SCSCG+YW Sbjct: 724 YASQLLEREIIVRDTHRFHHFKQSSCSCGEYW 755 >XP_007208039.1 hypothetical protein PRUPE_ppa002768mg [Prunus persica] Length = 635 Score = 67.8 bits (164), Expect = 4e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 Y SQLL+R+IIVRD HRFHHFKHG CSCGDYW Sbjct: 604 YTSQLLDREIIVRDLHRFHHFKHGLCSCGDYW 635 >XP_011466069.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Fragaria vesca subsp. vesca] Length = 736 Score = 67.8 bits (164), Expect = 4e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 + SQLL R+IIVRD HRFHHFKHGSCSCGDYW Sbjct: 705 FTSQLLNREIIVRDLHRFHHFKHGSCSCGDYW 736 >ONI05188.1 hypothetical protein PRUPE_6G360800 [Prunus persica] Length = 753 Score = 67.8 bits (164), Expect = 4e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 Y SQLL+R+IIVRD HRFHHFKHG CSCGDYW Sbjct: 722 YTSQLLDREIIVRDLHRFHHFKHGLCSCGDYW 753 >XP_019431235.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 isoform X1 [Lupinus angustifolius] OIW20530.1 hypothetical protein TanjilG_14059 [Lupinus angustifolius] Length = 740 Score = 67.4 bits (163), Expect = 5e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YASQLL R+IIVRD HRFHHFK+GSCSCGDYW Sbjct: 709 YASQLLGRQIIVRDIHRFHHFKNGSCSCGDYW 740 >XP_016690564.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Gossypium hirsutum] Length = 745 Score = 67.0 bits (162), Expect = 7e-11 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 Y SQLL+++IIVRD HRFHHFKHG CSCGDYW Sbjct: 714 YTSQLLDKEIIVRDIHRFHHFKHGCCSCGDYW 745 >XP_012476888.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Gossypium raimondii] Length = 745 Score = 67.0 bits (162), Expect = 7e-11 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 Y SQLL+++IIVRD HRFHHFKHG CSCGDYW Sbjct: 714 YTSQLLDKEIIVRDIHRFHHFKHGCCSCGDYW 745 >CBI17644.3 unnamed protein product, partial [Vitis vinifera] Length = 628 Score = 64.3 bits (155), Expect = 6e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 YAS+LL R+II+RD HRFHHFKHG CSC DYW Sbjct: 597 YASELLGREIIIRDIHRFHHFKHGHCSCADYW 628 >XP_010111070.1 hypothetical protein L484_015125 [Morus notabilis] EXC29932.1 hypothetical protein L484_015125 [Morus notabilis] Length = 705 Score = 64.3 bits (155), Expect = 6e-10 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 YASQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 Y SQLL R+IIVRD RFHHFKHGSCSCGDYW Sbjct: 674 YTSQLLGREIIVRDICRFHHFKHGSCSCGDYW 705 >XP_014496638.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Vigna radiata var. radiata] Length = 751 Score = 64.3 bits (155), Expect = 6e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 8 SQLLERKIIVRDTHRFHHFKHGSCSCGDYW 97 SQLL+R+IIVRD HRFHHFKHGSCSC DYW Sbjct: 722 SQLLDREIIVRDIHRFHHFKHGSCSCEDYW 751