BLASTX nr result
ID: Glycyrrhiza36_contig00023559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023559 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006594866.1 PREDICTED: equilibrative nucleotide transporter 3... 55 8e-07 >XP_006594866.1 PREDICTED: equilibrative nucleotide transporter 3 isoform X1 [Glycine max] Length = 431 Score = 55.1 bits (131), Expect = 8e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 168 D*KEASTAAMVNTTELPTRLEGKYAAIAVCWLLGN 272 D KEASTA MVN+ E+ TRLEGKYAAI VCWLLGN Sbjct: 9 DCKEASTAGMVNS-EVSTRLEGKYAAIVVCWLLGN 42