BLASTX nr result
ID: Glycyrrhiza36_contig00023529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023529 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterran... 61 2e-10 >GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterraneum] Length = 77 Score = 61.2 bits (147), Expect = 2e-10 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -1 Query: 228 LGLKKGGSDSPFLSQKREEAHKGCVNSVYAKDRKSNFTQTQS 103 LGL KGGSDSPF KREE KGCVNS AK+ K NFTQT S Sbjct: 24 LGLNKGGSDSPFFRLKREEVCKGCVNSNCAKNHKGNFTQTDS 65