BLASTX nr result
ID: Glycyrrhiza36_contig00023279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023279 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019440684.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 XP_015958667.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 6e-16 XP_016182918.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-15 XP_004500100.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 5e-15 XP_013459832.1 PPR containing plant-like protein [Medicago trunc... 76 7e-14 XP_010453662.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 1e-12 XP_010492360.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 5e-12 XP_010420187.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 8e-10 XP_006286917.1 hypothetical protein CARUB_v10000061mg [Capsella ... 64 1e-09 KFK25770.1 hypothetical protein AALP_AA8G157700 [Arabis alpina] 63 2e-09 XP_006431198.1 hypothetical protein CICLE_v10013587mg, partial [... 62 7e-09 XP_009376285.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 9e-09 XP_002533115.2 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 XP_006482624.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 KDO72616.1 hypothetical protein CISIN_1g000837mg [Citrus sinensis] 61 1e-08 XP_011035789.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 ONI19216.1 hypothetical protein PRUPE_3G265200 [Prunus persica] 60 2e-08 XP_006400048.1 hypothetical protein EUTSA_v10012473mg [Eutrema s... 60 2e-08 JAU20746.1 Pentatricopeptide repeat-containing protein [Noccaea ... 60 2e-08 XP_019157138.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 >XP_019440684.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Lupinus angustifolius] OIW13424.1 hypothetical protein TanjilG_33073 [Lupinus angustifolius] Length = 1259 Score = 86.7 bits (213), Expect = 1e-17 Identities = 43/73 (58%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSLSNNARARAGS--SLKTHLLELSTVVPGITRQFWRVPALRPEHV 259 +D +GFAQS+LS+ L NNA+ SL HLLELSTV+P TR+FWRVP L+PEHV Sbjct: 73 VDLNGFAQSVLSKCSLLDNNAKNHQTHVCSLNHHLLELSTVIPETTRKFWRVPVLKPEHV 132 Query: 260 LQILLGFQSECVR 298 L+IL GF+SEC + Sbjct: 133 LEILWGFESECAK 145 >XP_015958667.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Arachis duranensis] Length = 1234 Score = 81.6 bits (200), Expect = 6e-16 Identities = 42/73 (57%), Positives = 56/73 (76%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQ 265 +DFHG A S+LS+ SLSNN SLK LL++STV+P ITR+FW++P L P++VLQ Sbjct: 55 VDFHGLAGSILSK-CSLSNN---HTKPSLKDLLLDVSTVIPEITRKFWKLPQLDPQNVLQ 110 Query: 266 ILLGFQSECVRVG 304 +L+G+QSEC RVG Sbjct: 111 LLVGYQSECARVG 123 >XP_016182918.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Arachis ipaensis] Length = 1234 Score = 80.1 bits (196), Expect = 2e-15 Identities = 41/73 (56%), Positives = 56/73 (76%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQ 265 +DFHG A S+LS+ SLSNN SLK LL++STV+P ITR+FW++P L P++VL+ Sbjct: 55 VDFHGLAGSVLSK-CSLSNN---HTKPSLKDLLLDVSTVIPEITRRFWKLPQLDPQNVLE 110 Query: 266 ILLGFQSECVRVG 304 +L+G+QSEC RVG Sbjct: 111 LLVGYQSECARVG 123 >XP_004500100.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Cicer arietinum] Length = 1191 Score = 79.0 bits (193), Expect = 5e-15 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +2 Query: 128 PSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRVG 304 PSLSN SS K HLLELSTV+P ITRQFW +P L+P+HVL+ILL +QSECV VG Sbjct: 30 PSLSN-----PNSSFKPHLLELSTVIPEITRQFWTLPILKPQHVLEILLNYQSECVHVG 83 >XP_013459832.1 PPR containing plant-like protein [Medicago truncatula] KEH33863.1 PPR containing plant-like protein [Medicago truncatula] Length = 1200 Score = 75.9 bits (185), Expect = 7e-14 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 164 SSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRV 301 SSL HLL+LSTV+P ITRQFWR+P L+P+ VLQILLGFQSEC +V Sbjct: 36 SSLTPHLLQLSTVIPQITRQFWRIPVLKPQQVLQILLGFQSECAKV 81 >XP_010453662.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Camelina sativa] Length = 1220 Score = 72.4 bits (176), Expect = 1e-12 Identities = 38/64 (59%), Positives = 46/64 (71%) Frame = +2 Query: 113 LLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSEC 292 LLSR P + R GSSLK LL+LS VVP ITR+F RVP L+PE+VL++LLGFQSE Sbjct: 50 LLSRSPGGATKVRGDTGSSLKDLLLDLSDVVPNITRRFRRVPGLKPENVLELLLGFQSEV 109 Query: 293 VRVG 304 + G Sbjct: 110 QKDG 113 >XP_010492360.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Camelina sativa] Length = 1217 Score = 70.5 bits (171), Expect = 5e-12 Identities = 37/65 (56%), Positives = 46/65 (70%) Frame = +2 Query: 113 LLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSEC 292 LLSR P + R GSSLK LL+LS V+P ITR+F R P L+PE+VL++LLGFQSE Sbjct: 50 LLSRSPGGATKVRDVTGSSLKDLLLDLSDVIPNITRRFRRSPGLKPENVLELLLGFQSEV 109 Query: 293 VRVGT 307 + GT Sbjct: 110 EKDGT 114 >XP_010420187.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Camelina sativa] Length = 1229 Score = 64.3 bits (155), Expect = 8e-10 Identities = 35/64 (54%), Positives = 44/64 (68%) Frame = +2 Query: 113 LLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSEC 292 LLSR S + R GSSLK LL+ S VVP ITR+F R P L+PE+VL++LLGF+SE Sbjct: 58 LLSRSLSGATKVRDVTGSSLKDLLLDFSDVVPNITRRFRRFPGLKPENVLELLLGFESEI 117 Query: 293 VRVG 304 + G Sbjct: 118 QKDG 121 >XP_006286917.1 hypothetical protein CARUB_v10000061mg [Capsella rubella] EOA19815.1 hypothetical protein CARUB_v10000061mg [Capsella rubella] Length = 1230 Score = 63.9 bits (154), Expect = 1e-09 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = +2 Query: 110 SLLSREPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSE 289 +LLSR + R GS LK LL+LS VVP ITR F R P L+PE+VL++LLGFQ+E Sbjct: 60 NLLSRSVGGATKVRGVTGSYLKDLLLDLSDVVPNITRSFMRFPGLKPENVLELLLGFQTE 119 Query: 290 CVRVG 304 + G Sbjct: 120 VQKDG 124 >KFK25770.1 hypothetical protein AALP_AA8G157700 [Arabis alpina] Length = 1226 Score = 63.2 bits (152), Expect = 2e-09 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 137 SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRVG 304 +N GSSLK LLELS VVP ITR+F R P L+PE+VL++LLGF+SE R G Sbjct: 69 ANETHGFKGSSLKHLLLELSHVVPNITRRFRRFPCLKPENVLELLLGFESEVQRSG 124 >XP_006431198.1 hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] ESR44438.1 hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] Length = 1231 Score = 61.6 bits (148), Expect = 7e-09 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSL--SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHV 259 + F G A+S LSR L + ++ A +SLK LL +S VVP R+F R L+PE+V Sbjct: 46 VSFDGIAKSGLSRSSHLLETEKGKSYANASLKDLLLNISDVVPATARKFLRFLVLKPENV 105 Query: 260 LQILLGFQSECVRVGTR 310 L+IL+GF EC +VG R Sbjct: 106 LEILVGFWFECEKVGFR 122 >XP_009376285.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Pyrus x bretschneideri] Length = 1266 Score = 61.2 bits (147), Expect = 9e-09 Identities = 36/71 (50%), Positives = 45/71 (63%), Gaps = 2/71 (2%) Frame = +2 Query: 98 GFAQSLLSREPSL--SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQIL 271 G AQS+ SR N +R A +SLK LLE+ VVP TR+ RV AL+PE VL +L Sbjct: 82 GIAQSVFSRSSQFFDKNKSRDFANASLKDLLLEIYDVVPEYTRRIRRVSALKPEDVLGLL 141 Query: 272 LGFQSECVRVG 304 LGF+ +C RVG Sbjct: 142 LGFRFQCGRVG 152 >XP_002533115.2 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Ricinus communis] Length = 1212 Score = 60.8 bits (146), Expect = 1e-08 Identities = 33/81 (40%), Positives = 51/81 (62%), Gaps = 6/81 (7%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSLSNNARA------RAGSSLKTHLLELSTVVPGITRQFWRVPALR 247 I+F+GF++S +S+ P + R + LK LL++S V+P +TR+F R+ LR Sbjct: 72 INFNGFSESFISKYPHFFDIIETQRSNLYRDTNYLKELLLDISDVIPDLTRRFSRILRLR 131 Query: 248 PEHVLQILLGFQSECVRVGTR 310 PE VL+ILLGFQ +C +V + Sbjct: 132 PEDVLEILLGFQFQCEQVAIK 152 >XP_006482624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Citrus sinensis] Length = 1259 Score = 60.8 bits (146), Expect = 1e-08 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSL--SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHV 259 + F G A+S LSR L + ++ A +SLK LL +S VVP R+F R L+PE+V Sbjct: 77 VSFDGIAKSGLSRSSHLLETEKDKSYANASLKDLLLNISDVVPATARKFLRFLVLKPENV 136 Query: 260 LQILLGFQSECVRVGTR 310 L+IL+GF EC +VG R Sbjct: 137 LEILVGFWFECEKVGFR 153 >KDO72616.1 hypothetical protein CISIN_1g000837mg [Citrus sinensis] Length = 1262 Score = 60.8 bits (146), Expect = 1e-08 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 86 IDFHGFAQSLLSREPSL--SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHV 259 + F G A+S LSR L + ++ A +SLK LL +S VVP R+F R L+PE+V Sbjct: 77 VSFDGIAKSGLSRSSHLLETEKDKSYANASLKDLLLNISDVVPATARKFLRFLVLKPENV 136 Query: 260 LQILLGFQSECVRVGTR 310 L+IL+GF EC +VG R Sbjct: 137 LEILVGFWFECEKVGFR 153 >XP_011035789.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Populus euphratica] Length = 1255 Score = 60.5 bits (145), Expect = 2e-08 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 8/82 (9%) Frame = +2 Query: 89 DFHGFAQSLLSR--------EPSLSNNARARAGSSLKTHLLELSTVVPGITRQFWRVPAL 244 +F+G A S++S+ EP N +S K LL++S V+P +TR+F RV L Sbjct: 64 NFNGIAHSVISKCSHFFDKKEPKRHNFLN---DASFKMPLLDISDVIPHVTRRFLRVLRL 120 Query: 245 RPEHVLQILLGFQSECVRVGTR 310 +PE VL++LLGFQSEC RV + Sbjct: 121 KPEDVLEMLLGFQSECERVAVK 142 >ONI19216.1 hypothetical protein PRUPE_3G265200 [Prunus persica] Length = 1256 Score = 60.5 bits (145), Expect = 2e-08 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 2/71 (2%) Frame = +2 Query: 98 GFAQSLLSREPSLS--NNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQIL 271 G AQS++SR S N + A +SLK LLE+S VVP TR+ RV ++PE VL +L Sbjct: 67 GIAQSVISRCSHFSEKNKGKGFANASLKDLLLEISDVVPEYTRRLRRVSEVKPEDVLGLL 126 Query: 272 LGFQSECVRVG 304 LGFQ +C +VG Sbjct: 127 LGFQFQCGKVG 137 >XP_006400048.1 hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] ESQ41501.1 hypothetical protein EUTSA_v10012473mg [Eutrema salsugineum] Length = 1222 Score = 60.1 bits (144), Expect = 2e-08 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +2 Query: 149 RARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRVG 304 R GS LK LL+LS VVP ITR+F R P L+PE+VL++LLGFQSE R G Sbjct: 69 RGVTGSLLKDLLLDLSDVVPTITRRFRRFPGLKPENVLELLLGFQSELQRGG 120 >JAU20746.1 Pentatricopeptide repeat-containing protein [Noccaea caerulescens] Length = 1229 Score = 60.1 bits (144), Expect = 2e-08 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +2 Query: 137 SNNARARAGSSLKTHLLELSTVVPGITRQFWRVPALRPEHVLQILLGFQSECVRVG 304 + +RA GSSLK LL+L V+P ITR+F R P L PE+VL++LLGF+SE R G Sbjct: 66 AKESRAVTGSSLKDLLLDLFDVIPNITRRFRRFPGLNPENVLELLLGFESERQRGG 121 >XP_019157138.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Ipomoea nil] XP_019157139.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Ipomoea nil] XP_019157140.1 PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Ipomoea nil] Length = 1244 Score = 59.7 bits (143), Expect = 3e-08 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = +2 Query: 89 DFHGFAQSLLSREPSLSNNARARAG--SSLKTHLLELSTVVPGITRQFWRVPALRPEHVL 262 +F G A+ ++S+ L NN +A+ SSLK + L LS + P R+FWRV L+P+ VL Sbjct: 52 NFRGIAKHVISKCSHLCNNTKAQTSPNSSLKHYFLTLSCISPETVRKFWRVRLLKPQDVL 111 Query: 263 QILLGFQ 283 +ILLGFQ Sbjct: 112 EILLGFQ 118