BLASTX nr result
ID: Glycyrrhiza36_contig00023021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00023021 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU51432.1 hypothetical protein TSUD_301980 [Trifolium subterran... 53 9e-06 >GAU51432.1 hypothetical protein TSUD_301980 [Trifolium subterraneum] Length = 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +3 Query: 243 SLSPSGKLVGKLLQTTGRATVNVGAVNITHDPRS 344 SL PSGKLV L QTTGRAT N G+VNITHDP S Sbjct: 111 SLPPSGKLVTTLFQTTGRATNNFGSVNITHDPHS 144