BLASTX nr result
ID: Glycyrrhiza36_contig00022452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00022452 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015943343.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-16 XP_016177722.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-15 XP_017978085.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 7e-12 EOY28515.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 67 2e-11 KVH89595.1 Pentatricopeptide repeat-containing protein [Cynara c... 67 3e-11 XP_017646341.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 9e-11 XP_016683411.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 9e-11 XP_012450946.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-10 XP_012091437.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-10 XP_018807270.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 4e-10 KNA16260.1 hypothetical protein SOVF_090790 [Spinacia oleracea] 63 6e-10 OMP04344.1 hypothetical protein CCACVL1_02167 [Corchorus capsula... 62 1e-09 OMO64975.1 hypothetical protein COLO4_31672 [Corchorus olitorius] 62 1e-09 XP_010057692.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-09 OMO64974.1 hypothetical protein COLO4_31671 [Corchorus olitorius] 61 3e-09 XP_018856223.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-09 CBI41008.3 unnamed protein product, partial [Vitis vinifera] 61 3e-09 XP_003635182.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 CAN76851.1 hypothetical protein VITISV_005999 [Vitis vinifera] 61 3e-09 XP_002268636.2 PREDICTED: pentatricopeptide repeat-containing pr... 61 3e-09 >XP_015943343.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Arachis duranensis] Length = 398 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D+ TPEG+RNVV+ FK+ C+N FRR Y VR+LA+A+A+P+IEEIIE+QK+YKEI Sbjct: 56 DYETPEGMRNVVDKFKRLCKNKYFRRSVGIYTDVVRKLAKAKAFPLIEEIIEAQKQYKEI 115 Query: 11 SYE 3 + E Sbjct: 116 TTE 118 >XP_016177722.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Arachis ipaensis] Length = 432 Score = 79.0 bits (193), Expect = 1e-15 Identities = 36/63 (57%), Positives = 49/63 (77%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D+ TPE +RNVV+ FK+ C+N FRR Y VR+LA+A+A+P+IEEIIE+QK+YKEI Sbjct: 49 DYETPEAMRNVVDKFKRLCKNKYFRRSVGIYTDVVRKLAKAKAFPLIEEIIEAQKQYKEI 108 Query: 11 SYE 3 + E Sbjct: 109 TTE 111 >XP_017978085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial [Theobroma cacao] Length = 374 Score = 68.2 bits (165), Expect = 7e-12 Identities = 35/63 (55%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ VVE FKKSCEN +FR + Y TVRRLA A + IEEI+E QKKYK+I Sbjct: 29 DLYKERNLKRVVEKFKKSCENGRFRSQTGIYEGTVRRLASAGRFRWIEEILEEQKKYKDI 88 Query: 11 SYE 3 S E Sbjct: 89 SKE 91 >EOY28515.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 374 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/63 (53%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ VVE FKKSCEN +FR + Y TVRRLA A + IEEI+E QKKYK+I Sbjct: 29 DLYKERNLKRVVEKFKKSCENGRFRSQTGIYEGTVRRLASAGRFRWIEEILEEQKKYKDI 88 Query: 11 SYE 3 + E Sbjct: 89 AKE 91 >KVH89595.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 379 Score = 66.6 bits (161), Expect = 3e-11 Identities = 33/64 (51%), Positives = 42/64 (65%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 DD L+ VV+ FKK E++ FR+ A YG TVRRLA A+ + IEEI+E QK+Y E Sbjct: 26 DDLYKEHNLKRVVQKFKKLSESHMFRKHANVYGNTVRRLASAKKFNWIEEILEDQKQYDE 85 Query: 14 ISYE 3 IS E Sbjct: 86 ISKE 89 >XP_017646341.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Gossypium arboreum] Length = 374 Score = 65.1 bits (157), Expect = 9e-11 Identities = 32/64 (50%), Positives = 43/64 (67%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 +D L+ +VE FKKSCE ++FRRR+ Y VRRLA A + IEE++E QKKY++ Sbjct: 28 EDLYKERDLKRLVEKFKKSCEYSRFRRRSGIYEDIVRRLASAGRFQWIEEVLEDQKKYQD 87 Query: 14 ISYE 3 IS E Sbjct: 88 ISKE 91 >XP_016683411.1 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Gossypium hirsutum] Length = 374 Score = 65.1 bits (157), Expect = 9e-11 Identities = 32/64 (50%), Positives = 43/64 (67%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 +D L+ +VE FKKSCE ++FRRR+ Y VRRLA A + IEE++E QKKY++ Sbjct: 28 EDLYKERDLKRLVEKFKKSCEYSRFRRRSGIYEDIVRRLASAGRFQWIEEVLEDQKKYQD 87 Query: 14 ISYE 3 IS E Sbjct: 88 ISKE 91 >XP_012450946.1 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Gossypium raimondii] KJB66603.1 hypothetical protein B456_010G146600 [Gossypium raimondii] Length = 374 Score = 64.7 bits (156), Expect = 1e-10 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 +D L+ +VE FKKSCE + FRRR+ Y VRRLA A + IEE++E QKKY++ Sbjct: 28 EDLYKERDLKRLVEKFKKSCEYSHFRRRSGIYEDIVRRLASAGRFQWIEEVLEDQKKYQD 87 Query: 14 ISYE 3 IS E Sbjct: 88 ISKE 91 >XP_012091437.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Jatropha curcas] KDP20834.1 hypothetical protein JCGZ_21305 [Jatropha curcas] Length = 384 Score = 63.5 bits (153), Expect = 3e-10 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 D L+ +VE FKK EN +FR A TY TVRRL A+ + +I+EI+E QKKY+E Sbjct: 34 DAILKERNLKRLVEKFKKFSENKRFRANADTYKLTVRRLGAAKRFNLIQEILEDQKKYEE 93 Query: 14 ISYE 3 IS E Sbjct: 94 ISEE 97 >XP_018807270.1 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Juglans regia] Length = 379 Score = 63.2 bits (152), Expect = 4e-10 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ VVE FKKS E+ +FR R Y VRRLA A+ + IEEI+E QKKY++I Sbjct: 29 DIYNDRSLKRVVEKFKKSSEHERFRTRTGLYETVVRRLASAKCFNWIEEILEDQKKYRDI 88 Query: 11 SYE 3 S E Sbjct: 89 SKE 91 >KNA16260.1 hypothetical protein SOVF_090790 [Spinacia oleracea] Length = 381 Score = 62.8 bits (151), Expect = 6e-10 Identities = 29/56 (51%), Positives = 43/56 (76%) Frame = -1 Query: 170 LRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEISYE 3 L+ VVE+FKK +++ FR+RA Y +TVRRL+ + + +IEEI+E QKKYK+I+ E Sbjct: 34 LKKVVETFKKYTQDSNFRKRASFYEHTVRRLSNTKNFTLIEEILEDQKKYKDITDE 89 >OMP04344.1 hypothetical protein CCACVL1_02167 [Corchorus capsularis] Length = 348 Score = 62.0 bits (149), Expect = 1e-09 Identities = 32/64 (50%), Positives = 39/64 (60%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 DD L+ +VE FKKSCEN +FR Y TVRRLA A+ + IEEI+E QK+Y Sbjct: 29 DDLYKERNLKRLVEKFKKSCENPRFRCHIDLYEETVRRLAAARHFQWIEEILEQQKEYDN 88 Query: 14 ISYE 3 S E Sbjct: 89 FSKE 92 >OMO64975.1 hypothetical protein COLO4_31672 [Corchorus olitorius] Length = 371 Score = 62.0 bits (149), Expect = 1e-09 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = -1 Query: 194 DDFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 DD + +VE FKK CEN +FR + Y TVRRLA AQ + IEEI+E QKKY Sbjct: 29 DDLYKERSPKCLVEKFKKCCENPRFRNQTGVYEETVRRLAAAQRFQWIEEILEEQKKYDN 88 Query: 14 ISYE 3 S E Sbjct: 89 FSKE 92 >XP_010057692.1 PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial [Eucalyptus grandis] Length = 385 Score = 61.2 bits (147), Expect = 2e-09 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = -1 Query: 191 DFTTPE-GLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKE 15 DF E L+ +V FKKS + FR + TY Y VRRLA A+ + M+EEI+E QKKY++ Sbjct: 34 DFLYKERSLKRLVAQFKKSSAFDHFRTKIGTYQYAVRRLASARRFDMVEEILEEQKKYRD 93 Query: 14 ISYE 3 IS E Sbjct: 94 ISKE 97 >OMO64974.1 hypothetical protein COLO4_31671 [Corchorus olitorius] Length = 375 Score = 60.8 bits (146), Expect = 3e-09 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -1 Query: 167 RNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEISYE 3 + +VE FKK CEN +FR + Y TVRRLA Q + IEEI+E QKKY + S E Sbjct: 38 KRLVEKFKKGCENRRFRNQTGVYEETVRRLAALQRFRWIEEILEEQKKYHDFSKE 92 >XP_018856223.1 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like, partial [Juglans regia] Length = 271 Score = 60.5 bits (145), Expect = 3e-09 Identities = 33/63 (52%), Positives = 40/63 (63%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ VVE FKKS EN +FR R R Y VRRLA A+ + IEEI+E QKK ++I Sbjct: 49 DIYNDRSLKRVVEKFKKSSENERFRNRTRLYEI-VRRLASAKCFNWIEEILEDQKKSRDI 107 Query: 11 SYE 3 S E Sbjct: 108 SKE 110 >CBI41008.3 unnamed protein product, partial [Vitis vinifera] Length = 379 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ +V+ FKKS E ++FR + Y TVRRLA A+ + IEEI+E QKKYK+I Sbjct: 40 DIYRERNLKRLVQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDI 99 Query: 11 SYE 3 S E Sbjct: 100 SRE 102 >XP_003635182.1 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Vitis vinifera] Length = 382 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ +V+ FKKS E ++FR + Y TVRRLA A+ + IEEI+E QKKYK+I Sbjct: 32 DIYRERNLKRLVQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDI 91 Query: 11 SYE 3 S E Sbjct: 92 SRE 94 >CAN76851.1 hypothetical protein VITISV_005999 [Vitis vinifera] Length = 383 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ +V+ FKKS E ++FR + Y TVRRLA A+ + IEEI+E QKKYK+I Sbjct: 32 DIYRERNLKRLVQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDI 91 Query: 11 SYE 3 S E Sbjct: 92 SRE 94 >XP_002268636.2 PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial [Vitis vinifera] Length = 383 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 191 DFTTPEGLRNVVESFKKSCENNQFRRRARTYGYTVRRLAEAQAYPMIEEIIESQKKYKEI 12 D L+ +V+ FKKS E ++FR + Y TVRRLA A+ + IEEI+E QKKYK+I Sbjct: 32 DIYRERNLKRLVQKFKKSSELDRFRTKTGIYEETVRRLASAKRFRWIEEILEEQKKYKDI 91 Query: 11 SYE 3 S E Sbjct: 92 SRE 94