BLASTX nr result
ID: Glycyrrhiza36_contig00022156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00022156 (499 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004508660.1 PREDICTED: uncharacterized protein C13E7.11 [Cice... 59 2e-07 >XP_004508660.1 PREDICTED: uncharacterized protein C13E7.11 [Cicer arietinum] Length = 325 Score = 59.3 bits (142), Expect = 2e-07 Identities = 32/74 (43%), Positives = 44/74 (59%) Frame = +2 Query: 173 QGIPASQTEGGRVINPSKELVLGASGALIGILMADYYLFGEAYAHFPPTFKAVPLALGIF 352 Q A ++G R INPSKEL LGASGA+ I++ D +L+ A +F LGIF Sbjct: 226 QAYKAQTSKGWRAINPSKELALGASGAVNAIMLLDIFLYPRATLYFYFVIPVPAALLGIF 285 Query: 353 AIEKWMLSVMKGDT 394 I K ML +++GD+ Sbjct: 286 LIGKDMLRIIEGDS 299