BLASTX nr result
ID: Glycyrrhiza36_contig00021401
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00021401 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU33402.1 hypothetical protein TSUD_20950 [Trifolium subterraneum] 54 6e-06 >GAU33402.1 hypothetical protein TSUD_20950 [Trifolium subterraneum] Length = 1594 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/73 (30%), Positives = 46/73 (63%), Gaps = 3/73 (4%) Frame = -3 Query: 215 DSSDASSKSVMVASD---SDIHRSNQQYWKKYERDVAAKVWKLAKQMGVTGGEDDSAYIK 45 ++S +S+ S++ S ++I N+ +W K+E +V K+W+ K +GV G E D Y++ Sbjct: 578 ETSLSSAGSILYCSSLKSTEIRNCNKNFWNKHEAEVNGKLWERVKDLGVEGEEGDEVYVE 637 Query: 44 EIQKMEDRDGQAK 6 +++ E++D +A+ Sbjct: 638 QLRSNENKDKEAR 650