BLASTX nr result
ID: Glycyrrhiza36_contig00021138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00021138 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23715.1 hypothetical protein TSUD_46450 [Trifolium subterraneum] 70 3e-11 GAU23714.1 hypothetical protein TSUD_46440 [Trifolium subterraneum] 70 3e-11 XP_003592404.1 copper amine oxidase, enzyme domain protein [Medi... 67 4e-10 KRG91285.1 hypothetical protein GLYMA_20G145200 [Glycine max] 66 5e-10 XP_003556043.1 PREDICTED: primary amine oxidase-like isoform X1 ... 66 5e-10 XP_007143247.1 hypothetical protein PHAVU_007G056400g [Phaseolus... 64 3e-09 XP_007143248.1 hypothetical protein PHAVU_007G056400g [Phaseolus... 64 3e-09 XP_014524159.1 PREDICTED: primary amine oxidase-like [Vigna radi... 64 5e-09 KYP75032.1 Primary amine oxidase [Cajanus cajan] 63 6e-09 KHN15776.1 Primary amine oxidase [Glycine soja] 62 2e-08 XP_003555339.1 PREDICTED: primary amine oxidase-like [Glycine ma... 62 2e-08 XP_015941624.1 PREDICTED: primary amine oxidase-like [Arachis du... 61 4e-08 XP_016175742.1 PREDICTED: primary amine oxidase-like [Arachis ip... 58 5e-07 XP_018840460.1 PREDICTED: primary amine oxidase-like [Juglans re... 57 6e-07 CAN76699.1 hypothetical protein VITISV_012123 [Vitis vinifera] 57 1e-06 XP_002278182.1 PREDICTED: primary amine oxidase [Vitis vinifera]... 57 1e-06 XP_019454740.1 PREDICTED: primary amine oxidase-like [Lupinus an... 57 1e-06 XP_002315777.2 hypothetical protein POPTR_0010s09920g [Populus t... 55 3e-06 OAY55781.1 hypothetical protein MANES_03G179700 [Manihot esculenta] 55 6e-06 XP_011021542.1 PREDICTED: primary amine oxidase-like [Populus eu... 55 6e-06 >GAU23715.1 hypothetical protein TSUD_46450 [Trifolium subterraneum] Length = 497 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFE NPVLKTKSPKP+HW NCTSQH Sbjct: 466 FELRPTNFFERNPVLKTKSPKPIHWPNCTSQH 497 >GAU23714.1 hypothetical protein TSUD_46440 [Trifolium subterraneum] Length = 615 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFE NPVLKTKSPKP+HW NCTSQH Sbjct: 584 FELRPTNFFERNPVLKTKSPKPIHWPNCTSQH 615 >XP_003592404.1 copper amine oxidase, enzyme domain protein [Medicago truncatula] AES62655.1 copper amine oxidase, enzyme domain protein [Medicago truncatula] Length = 675 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKTKSPK VHW NCT QH Sbjct: 644 FELRPTNFFESNPVLKTKSPKAVHWPNCTFQH 675 >KRG91285.1 hypothetical protein GLYMA_20G145200 [Glycine max] Length = 469 Score = 66.2 bits (160), Expect = 5e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFE NPVLKTKSPKPVH+ NCTSQH Sbjct: 438 FELRPTNFFERNPVLKTKSPKPVHFPNCTSQH 469 >XP_003556043.1 PREDICTED: primary amine oxidase-like isoform X1 [Glycine max] KHN15777.1 Primary amine oxidase [Glycine soja] KRG91283.1 hypothetical protein GLYMA_20G145200 [Glycine max] Length = 675 Score = 66.2 bits (160), Expect = 5e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFE NPVLKTKSPKPVH+ NCTSQH Sbjct: 644 FELRPTNFFERNPVLKTKSPKPVHFPNCTSQH 675 >XP_007143247.1 hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris] ESW15241.1 hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris] Length = 469 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKTKSPK + W NCTSQH Sbjct: 438 FELRPTNFFESNPVLKTKSPKLLQWPNCTSQH 469 >XP_007143248.1 hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris] ESW15242.1 hypothetical protein PHAVU_007G056400g [Phaseolus vulgaris] Length = 667 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKTKSPK + W NCTSQH Sbjct: 636 FELRPTNFFESNPVLKTKSPKLLQWPNCTSQH 667 >XP_014524159.1 PREDICTED: primary amine oxidase-like [Vigna radiata var. radiata] Length = 676 Score = 63.5 bits (153), Expect = 5e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQ 326 FELRPTNFFESNPVLKT+SPKP+ W NCTSQ Sbjct: 646 FELRPTNFFESNPVLKTRSPKPLQWPNCTSQ 676 >KYP75032.1 Primary amine oxidase [Cajanus cajan] Length = 575 Score = 63.2 bits (152), Expect = 6e-09 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKTKSP V W NCTSQH Sbjct: 544 FELRPTNFFESNPVLKTKSPNYVQWPNCTSQH 575 >KHN15776.1 Primary amine oxidase [Glycine soja] Length = 551 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKT SPK V W NCTSQH Sbjct: 520 FELRPTNFFESNPVLKTLSPKLVGWPNCTSQH 551 >XP_003555339.1 PREDICTED: primary amine oxidase-like [Glycine max] KRG91286.1 hypothetical protein GLYMA_20G145300 [Glycine max] Length = 677 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQH 323 FELRPTNFFESNPVLKT SPK V W NCTSQH Sbjct: 646 FELRPTNFFESNPVLKTLSPKLVGWPNCTSQH 677 >XP_015941624.1 PREDICTED: primary amine oxidase-like [Arachis duranensis] Length = 673 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCT 332 FELRPTNFFE NPVLKTKSP+P HW NCT Sbjct: 644 FELRPTNFFERNPVLKTKSPEPAHWSNCT 672 >XP_016175742.1 PREDICTED: primary amine oxidase-like [Arachis ipaensis] Length = 673 Score = 57.8 bits (138), Expect = 5e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCT 332 FELRPTNFFE NPVLKTKS +P HW NCT Sbjct: 644 FELRPTNFFERNPVLKTKSTEPAHWSNCT 672 >XP_018840460.1 PREDICTED: primary amine oxidase-like [Juglans regia] Length = 679 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTS 329 FELRPTNFFESNPVLKTK PK V W NCT+ Sbjct: 645 FELRPTNFFESNPVLKTKPPKHVDWSNCTT 674 >CAN76699.1 hypothetical protein VITISV_012123 [Vitis vinifera] Length = 654 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCT 332 FELRPTNFFE+NPVLKTK P PV W NCT Sbjct: 625 FELRPTNFFENNPVLKTKPPTPVSWPNCT 653 >XP_002278182.1 PREDICTED: primary amine oxidase [Vitis vinifera] CBI26233.3 unnamed protein product, partial [Vitis vinifera] Length = 667 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCT 332 FELRPTNFFE+NPVLKTK P PV W NCT Sbjct: 638 FELRPTNFFENNPVLKTKPPTPVSWPNCT 666 >XP_019454740.1 PREDICTED: primary amine oxidase-like [Lupinus angustifolius] OIW05392.1 hypothetical protein TanjilG_28857 [Lupinus angustifolius] Length = 676 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQ 326 FELRPTNFFESNPVLKTK PKPV CTSQ Sbjct: 645 FELRPTNFFESNPVLKTKQPKPVRVPKCTSQ 675 >XP_002315777.2 hypothetical protein POPTR_0010s09920g [Populus trichocarpa] EEF01948.2 hypothetical protein POPTR_0010s09920g [Populus trichocarpa] Length = 366 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQ 326 FELRP NFFESNPVLK PKPV W NCT++ Sbjct: 335 FELRPANFFESNPVLKVVPPKPVRWTNCTAK 365 >OAY55781.1 hypothetical protein MANES_03G179700 [Manihot esculenta] Length = 673 Score = 54.7 bits (130), Expect = 6e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTS 329 FELRPTNFFE NPVLK K P+P+ W NC++ Sbjct: 642 FELRPTNFFEKNPVLKVKPPQPIQWTNCSA 671 >XP_011021542.1 PREDICTED: primary amine oxidase-like [Populus euphratica] Length = 675 Score = 54.7 bits (130), Expect = 6e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 418 FELRPTNFFESNPVLKTKSPKPVHWLNCTSQ 326 FELRP NFFESNPVLK PKPV W NCT++ Sbjct: 644 FELRPANFFESNPVLKVLPPKPVRWPNCTAK 674