BLASTX nr result
ID: Glycyrrhiza36_contig00021132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00021132 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003551734.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 2e-29 BAT83363.1 hypothetical protein VIGAN_04050100 [Vigna angularis ... 116 2e-28 XP_007134995.1 hypothetical protein PHAVU_010G093000g [Phaseolus... 115 6e-28 XP_014497950.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 8e-28 XP_004491806.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 1e-25 XP_003614030.1 PPR containing plant-like protein [Medicago trunc... 102 3e-23 XP_019446938.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 3e-19 KYP47297.1 Pentatricopeptide repeat-containing protein At2g36730... 87 4e-18 XP_016194283.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 4e-16 XP_015962763.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_015879446.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_011467963.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 3e-14 GAV58093.1 AAA domain-containing protein/Peptidase_M41 domain-co... 75 2e-13 XP_012084708.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 73 6e-13 XP_018814000.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 8e-13 CDX75017.1 BnaA05g07630D [Brassica napus] 72 2e-12 XP_013752267.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 XP_009143560.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 72 2e-12 XP_010509441.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 4e-12 XP_010505220.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 5e-12 >XP_003551734.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Glycine max] KRH01179.1 hypothetical protein GLYMA_18G259800 [Glycine max] Length = 505 Score = 119 bits (297), Expect = 2e-29 Identities = 61/89 (68%), Positives = 69/89 (77%) Frame = +1 Query: 49 MVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYF 228 ++R TL TQSLSK++Q CLSLLNSCRS+DQLRQIQAQ H+ GLY DT LSELVYF Sbjct: 2 VLRFRTLKTQSLSKKQQ----CLSLLNSCRSMDQLRQIQAQVHVSGLYQDTRVLSELVYF 57 Query: 229 CSLSPFKSLTHARRLVLHSNNPSPILWNI 315 CSLSP K+L HAR V H+ PSPI WNI Sbjct: 58 CSLSPSKNLRHARSFVHHAATPSPISWNI 86 >BAT83363.1 hypothetical protein VIGAN_04050100 [Vigna angularis var. angularis] Length = 502 Score = 116 bits (290), Expect = 2e-28 Identities = 61/89 (68%), Positives = 67/89 (75%) Frame = +1 Query: 49 MVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYF 228 MV LPTL TQ LSK+ +QCL LLN C S++QL QIQAQ HL GLY DTH LSELVYF Sbjct: 1 MVCLPTLKTQFLSKK----HQCLFLLNLCGSMEQLHQIQAQIHLSGLYQDTHTLSELVYF 56 Query: 229 CSLSPFKSLTHARRLVLHSNNPSPILWNI 315 CSLSP K+L HAR LV H+ PSPI WNI Sbjct: 57 CSLSPSKNLRHARALVHHAATPSPISWNI 85 >XP_007134995.1 hypothetical protein PHAVU_010G093000g [Phaseolus vulgaris] ESW06989.1 hypothetical protein PHAVU_010G093000g [Phaseolus vulgaris] Length = 502 Score = 115 bits (287), Expect = 6e-28 Identities = 61/89 (68%), Positives = 67/89 (75%) Frame = +1 Query: 49 MVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYF 228 MVRLPTLNTQ SK+ ++CL LLNSC S+DQLRQIQAQ HL GLY DTH LSELVYF Sbjct: 1 MVRLPTLNTQFFSKK----HECLFLLNSCGSMDQLRQIQAQIHLSGLYQDTHTLSELVYF 56 Query: 229 CSLSPFKSLTHARRLVLHSNNPSPILWNI 315 CSLSP K+L HA LV + SPI WNI Sbjct: 57 CSLSPSKNLRHACALVHDAATSSPISWNI 85 >XP_014497950.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Vigna radiata var. radiata] Length = 502 Score = 114 bits (286), Expect = 8e-28 Identities = 60/89 (67%), Positives = 67/89 (75%) Frame = +1 Query: 49 MVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYF 228 MV LPTL T+ LSK+ +QCL LLN C S++QL QIQAQ HL GLY DTH LSELVYF Sbjct: 1 MVCLPTLKTRFLSKK----HQCLFLLNLCGSMEQLHQIQAQIHLSGLYQDTHTLSELVYF 56 Query: 229 CSLSPFKSLTHARRLVLHSNNPSPILWNI 315 CSLSP K+L HAR LV H+ PSPI WNI Sbjct: 57 CSLSPSKNLRHARALVHHAATPSPISWNI 85 >XP_004491806.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Cicer arietinum] Length = 508 Score = 108 bits (271), Expect = 1e-25 Identities = 60/93 (64%), Positives = 71/93 (76%), Gaps = 4/93 (4%) Frame = +1 Query: 49 MVRLPTL-NTQSLSKQKQKHYQC-LSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELV 222 MVR TL NT SLSK+ H+QC LSLLNSCRSIDQL Q+Q+Q HL L+++TH S+LV Sbjct: 1 MVRFQTLLNTPSLSKKN--HHQCFLSLLNSCRSIDQLHQLQSQIHLNSLHNNTHLFSQLV 58 Query: 223 YFCSLSPFKSLTHARRLVLH--SNNPSPILWNI 315 Y SLSPFK+LT A +LV H +NNPSPI WNI Sbjct: 59 YLFSLSPFKNLTQAHKLVFHFSNNNPSPISWNI 91 >XP_003614030.1 PPR containing plant-like protein [Medicago truncatula] AES96988.1 PPR containing plant-like protein [Medicago truncatula] Length = 498 Score = 102 bits (253), Expect = 3e-23 Identities = 54/90 (60%), Positives = 64/90 (71%), Gaps = 1/90 (1%) Frame = +1 Query: 49 MVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYF 228 MVR TL + QCL+LLNS SI +L Q+QAQ HL L++DTH LS+LVYF Sbjct: 1 MVRFQTLTNKQ---------QCLNLLNSLHSITKLHQLQAQIHLNSLHNDTHILSQLVYF 51 Query: 229 CSLSPFKSLTHARRLVLH-SNNPSPILWNI 315 SLSPFK+L+HAR+LV H SNNPSPI WNI Sbjct: 52 FSLSPFKNLSHARKLVFHFSNNPSPISWNI 81 >XP_019446938.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Lupinus angustifolius] Length = 533 Score = 90.9 bits (224), Expect = 3e-19 Identities = 43/72 (59%), Positives = 52/72 (72%) Frame = +1 Query: 100 KHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVL 279 K CLSLLN C SI QL QIQ+Q H+ L+HDT L++L+Y SL PFK+L HA++LV Sbjct: 8 KKQLCLSLLNLCSSIKQLHQIQSQIHISDLHHDTFLLTQLIYSFSLKPFKNLNHAQKLVR 67 Query: 280 HSNNPSPILWNI 315 NNPSPI WNI Sbjct: 68 FCNNPSPISWNI 79 >KYP47297.1 Pentatricopeptide repeat-containing protein At2g36730 family [Cajanus cajan] Length = 364 Score = 87.0 bits (214), Expect = 4e-18 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = +1 Query: 142 IDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVLHSNNPSPILWNI 315 +DQLRQIQAQ H+ GLY DTH LS+LVYFCSLSP +L HAR L+ HS PSPI WN+ Sbjct: 1 MDQLRQIQAQIHVSGLYQDTHILSQLVYFCSLSPSNNLCHARTLLHHSATPSPISWNL 58 >XP_016194283.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Arachis ipaensis] Length = 499 Score = 82.0 bits (201), Expect = 4e-16 Identities = 39/70 (55%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = +1 Query: 109 QCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVLHS- 285 QCL+LL+ C SI QL QIQAQ+H+ GL+ D + LS+L+Y SLS F +LTHA+ ++ S Sbjct: 14 QCLTLLSLCSSITQLHQIQAQTHINGLFQDPYVLSQLIYLSSLSSFANLTHAKTILFRSP 73 Query: 286 NNPSPILWNI 315 PSPI WNI Sbjct: 74 TTPSPISWNI 83 >XP_015962763.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Arachis duranensis] Length = 503 Score = 80.9 bits (198), Expect = 1e-15 Identities = 39/70 (55%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +1 Query: 109 QCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVLHS- 285 QCL+LL+ C SI QL QIQAQ H+ GL+ D + LS+L+Y SLS F +LTHA+ ++ HS Sbjct: 18 QCLTLLSLCSSITQLHQIQAQIHINGLFQDPYVLSQLIYLSSLSSFANLTHAKTILFHSP 77 Query: 286 NNPSPILWNI 315 SPI WNI Sbjct: 78 TTSSPISWNI 87 >XP_015879446.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Ziziphus jujuba] XP_015867656.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Ziziphus jujuba] Length = 515 Score = 80.9 bits (198), Expect = 1e-15 Identities = 45/99 (45%), Positives = 56/99 (56%) Frame = +1 Query: 19 LRRETQKAKCMVRLPTLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHD 198 +R +TQ A + T + S K QCLSL C SI QL QI AQ HL GL D Sbjct: 2 VRLQTQTANRVFAPKTYHHPDSSDFVSKKQQCLSLFKICSSIKQLSQIHAQLHLSGLQGD 61 Query: 199 THFLSELVYFCSLSPFKSLTHARRLVLHSNNPSPILWNI 315 T L++LV FC+LSP K L HAR ++ S++ P WNI Sbjct: 62 TFLLTQLVRFCALSPSKDLNHARTILHRSDHSPPSSWNI 100 >XP_011467963.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Fragaria vesca subsp. vesca] Length = 505 Score = 77.0 bits (188), Expect = 3e-14 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 5/93 (5%) Frame = +1 Query: 49 MVRLP-----TLNTQSLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLS 213 MVRLP T N+ +SK++Q CLSLL+ C S QI AQ HL GL+ D + L+ Sbjct: 1 MVRLPIPTAKTCNSNFVSKKQQ----CLSLLSLCLSFKPFSQIHAQIHLSGLHRDPYLLT 56 Query: 214 ELVYFCSLSPFKSLTHARRLVLHSNNPSPILWN 312 +L+ FC+LSP K+ T+A+ L+ HS+ P WN Sbjct: 57 QLIKFCALSPAKNFTYAQTLLRHSSASPPSSWN 89 >GAV58093.1 AAA domain-containing protein/Peptidase_M41 domain-containing protein/PPR domain-containing protein, partial [Cephalotus follicularis] Length = 1158 Score = 74.7 bits (182), Expect = 2e-13 Identities = 37/72 (51%), Positives = 49/72 (68%) Frame = +1 Query: 100 KHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVL 279 K +QCLSLL C S + QI AQ + GL+ D+ LSELV FCSLSPFK+L++AR L+ Sbjct: 676 KKHQCLSLLKQCSSTKDVSQIHAQIQVSGLHQDSFLLSELVRFCSLSPFKNLSYARSLLD 735 Query: 280 HSNNPSPILWNI 315 S N +P W++ Sbjct: 736 ASVNSAPSSWSM 747 >XP_012084708.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 6, chloroplastic [Jatropha curcas] Length = 1159 Score = 73.2 bits (178), Expect = 6e-13 Identities = 39/81 (48%), Positives = 51/81 (62%), Gaps = 3/81 (3%) Frame = +1 Query: 82 LSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTH 261 +S+ K QCL LL C SI QL Q+ AQ L GL HDT +SEL+ FCSLS ++L++ Sbjct: 662 VSENKVHRTQCLCLLKLCSSIKQLSQVHAQIQLSGLQHDTFLISELIRFCSLSQSRNLSY 721 Query: 262 ARRLVLHSNNPSPI---LWNI 315 A+ L+ HS N P+ WNI Sbjct: 722 AQSLLDHSINSVPLPPPSWNI 742 >XP_018814000.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Juglans regia] Length = 514 Score = 72.8 bits (177), Expect = 8e-13 Identities = 35/72 (48%), Positives = 47/72 (65%) Frame = +1 Query: 100 KHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHARRLVL 279 K +QCL LL C S L Q+ AQ + GL+ D+ SELV C+LSP SL++AR L+ Sbjct: 27 KKHQCLVLLKLCSSTKHLSQVHAQMQVTGLHRDSFLASELVRICALSPTGSLSYARSLLY 86 Query: 280 HSNNPSPILWNI 315 HS++ SP+ WNI Sbjct: 87 HSDDSSPLPWNI 98 >CDX75017.1 BnaA05g07630D [Brassica napus] Length = 473 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/77 (50%), Positives = 46/77 (59%) Frame = +1 Query: 85 SKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHA 264 S K K +QCL L C SI L QI AQ HL L D+ +SELV SLS K LT A Sbjct: 3 SSFKSKKHQCLVFLKLCSSIKHLLQIHAQVHLSALQSDSFIISELVRVSSLSHSKDLTFA 62 Query: 265 RRLVLHSNNPSPILWNI 315 R L+LHS++ SP WN+ Sbjct: 63 RTLLLHSSDSSPSTWNM 79 >XP_013752267.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Brassica napus] Length = 502 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/77 (50%), Positives = 46/77 (59%) Frame = +1 Query: 85 SKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHA 264 S K K +QCL L C SI L QI AQ HL L D+ +SELV SLS K LT A Sbjct: 3 SSFKSKKHQCLVFLKLCSSIKHLLQIHAQVHLSALQSDSFIISELVRVSSLSHSKDLTFA 62 Query: 265 RRLVLHSNNPSPILWNI 315 R L+LHS++ SP WN+ Sbjct: 63 RTLLLHSSDSSPSTWNM 79 >XP_009143560.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g36730 [Brassica rapa] Length = 502 Score = 71.6 bits (174), Expect = 2e-12 Identities = 39/77 (50%), Positives = 46/77 (59%) Frame = +1 Query: 85 SKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTHA 264 S K K +QCL L C SI L QI AQ HL L D+ +SELV SLS K LT A Sbjct: 3 SSFKSKKHQCLVFLKLCSSIKHLLQIHAQVHLSALQSDSFIISELVRVSSLSHSKDLTFA 62 Query: 265 RRLVLHSNNPSPILWNI 315 R L+LHS++ SP WN+ Sbjct: 63 RTLLLHSSDSSPSTWNM 79 >XP_010509441.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730-like [Camelina sativa] Length = 499 Score = 70.9 bits (172), Expect = 4e-12 Identities = 37/78 (47%), Positives = 48/78 (61%) Frame = +1 Query: 82 LSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLTH 261 +S K K +QCL LL C SI L QI Q H+ L +D+ +SELV SLS K LT Sbjct: 1 MSSFKSKKHQCLILLKLCSSIKHLLQIHGQVHVSALQNDSFIISELVRVSSLSHAKDLTF 60 Query: 262 ARRLVLHSNNPSPILWNI 315 AR L+LHS++ +P WN+ Sbjct: 61 ARTLLLHSSDSTPSTWNM 78 >XP_010505220.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Camelina sativa] Length = 504 Score = 70.5 bits (171), Expect = 5e-12 Identities = 38/79 (48%), Positives = 48/79 (60%) Frame = +1 Query: 79 SLSKQKQKHYQCLSLLNSCRSIDQLRQIQAQSHLRGLYHDTHFLSELVYFCSLSPFKSLT 258 S S K K +QCL LL C SI L QI Q H+ L +D+ +SELV SLS K LT Sbjct: 5 SESSFKSKKHQCLILLKLCSSIKHLLQIHGQIHVSALQNDSFIISELVRVSSLSHAKDLT 64 Query: 259 HARRLVLHSNNPSPILWNI 315 AR L+LHS++ +P WN+ Sbjct: 65 FARTLLLHSSDSTPSTWNM 83