BLASTX nr result
ID: Glycyrrhiza36_contig00021050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00021050 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN09773.1 Putative DNA-binding protein ESCAROLA [Glycine soja] 58 5e-08 XP_003525782.1 PREDICTED: AT-hook motif nuclear-localized protei... 58 7e-08 XP_003549894.1 PREDICTED: AT-hook motif nuclear-localized protei... 58 7e-08 XP_007155606.1 hypothetical protein PHAVU_003G216200g [Phaseolus... 55 7e-07 KZN08320.1 hypothetical protein DCAR_000866 [Daucus carota subsp... 54 8e-07 XP_012087074.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 1e-06 XP_017220279.1 PREDICTED: LOW QUALITY PROTEIN: AT-hook motif nuc... 54 2e-06 XP_016553021.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_004245690.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_015084525.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_006363711.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_016553013.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_019252292.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_019252291.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 OAY56623.1 hypothetical protein MANES_02G032200 [Manihot esculenta] 54 2e-06 XP_015865801.1 PREDICTED: AT-hook motif nuclear-localized protei... 54 2e-06 XP_009763803.1 PREDICTED: putative DNA-binding protein ESCAROLA ... 53 5e-06 XP_009763802.1 PREDICTED: putative DNA-binding protein ESCAROLA ... 53 5e-06 OMO97303.1 hypothetical protein CCACVL1_04607 [Corchorus capsula... 53 5e-06 OMO80966.1 hypothetical protein COLO4_23843 [Corchorus olitorius] 53 5e-06 >KHN09773.1 Putative DNA-binding protein ESCAROLA [Glycine soja] Length = 230 Score = 57.8 bits (138), Expect = 5e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNS+QMPSEPFWA + RPP+ Sbjct: 200 APLFHGLPPNLLNSVQMPSEPFWAASTRPPF 230 >XP_003525782.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Glycine max] XP_006579618.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Glycine max] XP_014630968.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Glycine max] KHN04317.1 Putative DNA-binding protein ESCAROLA [Glycine soja] KRH57320.1 hypothetical protein GLYMA_05G054200 [Glycine max] Length = 283 Score = 57.8 bits (138), Expect = 7e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNS+QMPSEPFWA + RPP+ Sbjct: 253 APLFHGLPPNLLNSVQMPSEPFWAASARPPF 283 >XP_003549894.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Glycine max] KRH04051.1 hypothetical protein GLYMA_17G136600 [Glycine max] Length = 287 Score = 57.8 bits (138), Expect = 7e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNS+QMPSEPFWA + RPP+ Sbjct: 257 APLFHGLPPNLLNSVQMPSEPFWAASTRPPF 287 >XP_007155606.1 hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris] ESW27600.1 hypothetical protein PHAVU_003G216200g [Phaseolus vulgaris] Length = 284 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 270 AASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 AA LFHG+ PNLLNS+QMPSEPFWA+ RPP+ Sbjct: 254 AAPLFHGLPPNLLNSVQMPSEPFWASN-RPPF 284 >KZN08320.1 hypothetical protein DCAR_000866 [Daucus carota subsp. sativus] Length = 182 Score = 53.9 bits (128), Expect = 8e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 S+FHGM+PNLLNSIQ+P E FWA+ RPPY Sbjct: 153 SMFHGMAPNLLNSIQLPPEAFWASGGRPPY 182 >XP_012087074.1 PREDICTED: AT-hook motif nuclear-localized protein 24 [Jatropha curcas] KDP25577.1 hypothetical protein JCGZ_20733 [Jatropha curcas] Length = 295 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNSIQ+P+E +WAT RPPY Sbjct: 265 AQLFHGLQPNLLNSIQLPTEAYWATGGRPPY 295 >XP_017220279.1 PREDICTED: LOW QUALITY PROTEIN: AT-hook motif nuclear-localized protein 24 [Daucus carota subsp. sativus] Length = 283 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 S+FHGM+PNLLNSIQ+P E FWA+ RPPY Sbjct: 254 SMFHGMAPNLLNSIQLPPEAFWASGGRPPY 283 >XP_016553021.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like isoform X2 [Capsicum annuum] Length = 292 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 264 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 292 >XP_004245690.1 PREDICTED: AT-hook motif nuclear-localized protein 24 [Solanum lycopersicum] Length = 292 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 264 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 292 >XP_015084525.1 PREDICTED: AT-hook motif nuclear-localized protein 24 [Solanum pennellii] Length = 293 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 265 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 293 >XP_006363711.1 PREDICTED: AT-hook motif nuclear-localized protein 24 [Solanum tuberosum] Length = 293 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 265 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 293 >XP_016553013.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like isoform X1 [Capsicum annuum] Length = 295 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 267 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 295 >XP_019252292.1 PREDICTED: AT-hook motif nuclear-localized protein 22-like isoform X2 [Nicotiana attenuata] Length = 298 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 270 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 298 >XP_019252291.1 PREDICTED: AT-hook motif nuclear-localized protein 22-like isoform X1 [Nicotiana attenuata] OIS99559.1 at-hook motif nuclear-localized protein 22 [Nicotiana attenuata] Length = 301 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+PSEP+WA T RPP+ Sbjct: 273 SLFHGMPPNLLNSIQLPSEPYWA-TGRPPF 301 >OAY56623.1 hypothetical protein MANES_02G032200 [Manihot esculenta] Length = 293 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNSIQ+P+EP+WA T RPPY Sbjct: 264 AQLFHGLQPNLLNSIQLPTEPYWA-TGRPPY 293 >XP_015865801.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Ziziphus jujuba] Length = 306 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -3 Query: 270 AASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 +A LFHG+ PNLLNSIQMP+E +WAT RPP+ Sbjct: 275 SAPLFHGLPPNLLNSIQMPAEAYWATGGRPPF 306 >XP_009763803.1 PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana sylvestris] XP_016434023.1 PREDICTED: AT-hook motif nuclear-localized protein 22-like isoform X2 [Nicotiana tabacum] Length = 291 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+P+EP+WA T RPP+ Sbjct: 263 SLFHGMPPNLLNSIQLPTEPYWA-TGRPPF 291 >XP_009763802.1 PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana sylvestris] XP_016434022.1 PREDICTED: AT-hook motif nuclear-localized protein 22-like isoform X1 [Nicotiana tabacum] Length = 294 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 264 SLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 SLFHGM PNLLNSIQ+P+EP+WA T RPP+ Sbjct: 266 SLFHGMPPNLLNSIQLPTEPYWA-TGRPPF 294 >OMO97303.1 hypothetical protein CCACVL1_04607 [Corchorus capsularis] Length = 296 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNSIQ+P+E FWAT RPP+ Sbjct: 266 APLFHGVPPNLLNSIQLPTEAFWATGGRPPF 296 >OMO80966.1 hypothetical protein COLO4_23843 [Corchorus olitorius] Length = 296 Score = 52.8 bits (125), Expect = 5e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 267 ASLFHGMSPNLLNSIQMPSEPFWATTPRPPY 175 A LFHG+ PNLLNSIQ+P+E FWAT RPP+ Sbjct: 266 APLFHGVPPNLLNSIQLPTEAFWATGGRPPF 296