BLASTX nr result
ID: Glycyrrhiza36_contig00020174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00020174 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019437470.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 8e-23 KHN03010.1 Pentatricopeptide repeat-containing protein, mitochon... 99 3e-22 XP_003528655.2 PREDICTED: pentatricopeptide repeat-containing pr... 99 4e-22 KYP58039.1 hypothetical protein KK1_004330 [Cajanus cajan] 96 3e-21 XP_003609573.2 PPR containing plant-like protein [Medicago trunc... 92 8e-20 XP_015939208.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 3e-18 XP_016171688.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 4e-17 XP_004508318.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 9e-16 XP_004508317.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 9e-16 XP_007154218.1 hypothetical protein PHAVU_003G100100g [Phaseolus... 75 7e-14 XP_014506753.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 5e-13 BAT77184.1 hypothetical protein VIGAN_01527900 [Vigna angularis ... 72 1e-12 XP_017431033.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 2e-12 KDP40035.1 hypothetical protein JCGZ_02033 [Jatropha curcas] 66 1e-10 XP_012069909.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 KCW60975.1 hypothetical protein EUGRSUZ_H03713 [Eucalyptus grandis] 64 1e-09 XP_002516850.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-09 XP_018825968.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 1e-09 CBI26127.3 unnamed protein product, partial [Vitis vinifera] 63 2e-09 XP_002276935.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 >XP_019437470.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Lupinus angustifolius] Length = 627 Score = 100 bits (250), Expect = 8e-23 Identities = 48/56 (85%), Positives = 50/56 (89%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 KKVPGSSWIEIRN VTAFVSGNNSYPYMADIS+ILY LELEMRHTWP N D + SL Sbjct: 572 KKVPGSSWIEIRNEVTAFVSGNNSYPYMADISEILYFLELEMRHTWPLNFDTDRSL 627 >KHN03010.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 496 Score = 99.0 bits (245), Expect = 3e-22 Identities = 48/56 (85%), Positives = 50/56 (89%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 KKVPGSSWIEIRN VT+FVSGNN+YPYMADISKILY LELEMRHT P N DIEG L Sbjct: 441 KKVPGSSWIEIRNEVTSFVSGNNAYPYMADISKILYFLELEMRHTSPINFDIEGPL 496 >XP_003528655.2 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Glycine max] KRH50935.1 hypothetical protein GLYMA_07G252200 [Glycine max] Length = 632 Score = 99.0 bits (245), Expect = 4e-22 Identities = 48/56 (85%), Positives = 50/56 (89%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 KKVPGSSWIEIRN VT+FVSGNN+YPYMADISKILY LELEMRHT P N DIEG L Sbjct: 577 KKVPGSSWIEIRNEVTSFVSGNNAYPYMADISKILYFLELEMRHTSPINFDIEGPL 632 >KYP58039.1 hypothetical protein KK1_004330 [Cajanus cajan] Length = 600 Score = 96.3 bits (238), Expect = 3e-21 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 KKVPGSSWIEIRN V AFVSGNN+YP +ADISKILY LELEMRHTWP + DIEG L Sbjct: 545 KKVPGSSWIEIRNQVIAFVSGNNAYPCVADISKILYFLELEMRHTWPIDFDIEGPL 600 >XP_003609573.2 PPR containing plant-like protein [Medicago truncatula] AES91770.2 PPR containing plant-like protein [Medicago truncatula] Length = 625 Score = 92.4 bits (228), Expect = 8e-20 Identities = 46/53 (86%), Positives = 46/53 (86%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIE 135 KKVPG SWIEIRNVVTAFVSGNN YP MADISKILY LELEMRHT P N DIE Sbjct: 573 KKVPGCSWIEIRNVVTAFVSGNNLYPCMADISKILYFLELEMRHTRPINFDIE 625 >XP_015939208.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial-like [Arachis duranensis] Length = 631 Score = 87.8 bits (216), Expect = 3e-18 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 +KVPGSSWIEIRN VTAFVSGNNS P+MA+ISK+L LELEMRH W N DIEG L Sbjct: 516 RKVPGSSWIEIRNKVTAFVSGNNSCPHMAEISKMLCFLELEMRHIWLINFDIEGRL 571 >XP_016171688.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Arachis ipaensis] Length = 570 Score = 84.7 bits (208), Expect = 4e-17 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIEGSL 126 +KVPGSSWIEIRN VTAFVSGNNS P++A+ISK+L LELEMRH W N DI+G L Sbjct: 515 RKVPGSSWIEIRNKVTAFVSGNNSCPHIAEISKMLCFLELEMRHIWLINFDIDGFL 570 >XP_004508318.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial isoform X2 [Cicer arietinum] Length = 541 Score = 80.9 bits (198), Expect = 9e-16 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSG-NNSYPYMADISKILYLLELEMRHT 159 KK+PG SWIEIRNVVTAFVSG NNSYP MAD+SKILY LELEMRHT Sbjct: 496 KKMPGCSWIEIRNVVTAFVSGNNNSYPCMADVSKILYFLELEMRHT 541 >XP_004508317.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial isoform X1 [Cicer arietinum] Length = 617 Score = 80.9 bits (198), Expect = 9e-16 Identities = 40/46 (86%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSG-NNSYPYMADISKILYLLELEMRHT 159 KK+PG SWIEIRNVVTAFVSG NNSYP MAD+SKILY LELEMRHT Sbjct: 572 KKMPGCSWIEIRNVVTAFVSGNNNSYPCMADVSKILYFLELEMRHT 617 >XP_007154218.1 hypothetical protein PHAVU_003G100100g [Phaseolus vulgaris] ESW26212.1 hypothetical protein PHAVU_003G100100g [Phaseolus vulgaris] Length = 619 Score = 75.5 bits (184), Expect = 7e-14 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KKV GSSWIEIRN VT+FVSGNN+YP+M +ISKILY L+LE+RH Sbjct: 575 KKVAGSSWIEIRNEVTSFVSGNNAYPFMPEISKILYFLQLELRH 618 >XP_014506753.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial-like [Vigna radiata var. radiata] Length = 325 Score = 72.4 bits (176), Expect = 5e-13 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KKV GSSWIEIRN +T+F+SGNN+YP+M++ISKIL+ L+LE+RH Sbjct: 281 KKVVGSSWIEIRNDITSFISGNNAYPFMSEISKILHFLQLEIRH 324 >BAT77184.1 hypothetical protein VIGAN_01527900 [Vigna angularis var. angularis] Length = 325 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KKV GSSWIEIRN +T+FVSGNN+YP+M +ISKIL+ L+LE+RH Sbjct: 281 KKVVGSSWIEIRNEMTSFVSGNNAYPFMPEISKILHFLQLEIRH 324 >XP_017431033.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Vigna angularis] KOM33560.1 hypothetical protein LR48_Vigan01g311600 [Vigna angularis] Length = 619 Score = 71.6 bits (174), Expect = 2e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KKV GSSWIEIRN +T+FVSGNN+YP+M +ISKIL+ L+LE+RH Sbjct: 575 KKVVGSSWIEIRNEMTSFVSGNNAYPFMPEISKILHFLQLEIRH 618 >KDP40035.1 hypothetical protein JCGZ_02033 [Jatropha curcas] Length = 593 Score = 66.2 bits (160), Expect = 1e-10 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 +K+PG SWIE+RN VT+FV+GN S+PYM ++ KILY LE EMR+ Sbjct: 542 RKMPGCSWIEVRNEVTSFVAGNRSHPYMENLCKILYFLEFEMRN 585 >XP_012069909.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Jatropha curcas] Length = 623 Score = 66.2 bits (160), Expect = 1e-10 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 +K+PG SWIE+RN VT+FV+GN S+PYM ++ KILY LE EMR+ Sbjct: 572 RKMPGCSWIEVRNEVTSFVAGNRSHPYMENLCKILYFLEFEMRN 615 >KCW60975.1 hypothetical protein EUGRSUZ_H03713 [Eucalyptus grandis] Length = 580 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRHTWPNNSDIE 135 +K PG SWIE+RN VTAFV+GNNS+P M D+ ++L L+ E R + N S I+ Sbjct: 527 RKTPGCSWIEVRNAVTAFVAGNNSHPLMEDLHEVLCFLDFETRTSNTNTSSID 579 >XP_002516850.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Ricinus communis] EEF45464.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 623 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMR 165 KK+PG SWIE+RN VTAFV+GN+ YPY ++ K LY LE EMR Sbjct: 572 KKMPGCSWIEVRNKVTAFVAGNHLYPYTDELYKTLYFLEFEMR 614 >XP_018825968.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Juglans regia] Length = 623 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KK PG SWIE RN VTAFV+G++S+PY+ DI KIL++LE EM++ Sbjct: 572 KKRPGCSWIEARNKVTAFVAGSHSHPYLQDICKILHILEFEMKN 615 >CBI26127.3 unnamed protein product, partial [Vitis vinifera] Length = 603 Score = 62.8 bits (151), Expect = 2e-09 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KK+PG SWIE+RN VT FV+GN+S+PYM ++ KIL L+ EMR+ Sbjct: 552 KKMPGCSWIEVRNKVTVFVAGNHSHPYMEELCKILNFLKFEMRN 595 >XP_002276935.1 PREDICTED: pentatricopeptide repeat-containing protein At2g36980, mitochondrial [Vitis vinifera] Length = 623 Score = 62.8 bits (151), Expect = 2e-09 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 293 KKVPGSSWIEIRNVVTAFVSGNNSYPYMADISKILYLLELEMRH 162 KK+PG SWIE+RN VT FV+GN+S+PYM ++ KIL L+ EMR+ Sbjct: 572 KKMPGCSWIEVRNKVTVFVAGNHSHPYMEELCKILNFLKFEMRN 615