BLASTX nr result
ID: Glycyrrhiza36_contig00020170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00020170 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP41066.1 Putative disease resistance RPP13-like protein 1 [Caj... 56 2e-07 KYP41054.1 Putative disease resistance RPP13-like protein 1 [Caj... 56 2e-07 GAU39699.1 hypothetical protein TSUD_321120 [Trifolium subterran... 54 7e-07 XP_016182307.1 PREDICTED: putative disease resistance RPP13-like... 52 1e-06 XP_013466896.1 NB-ARC domain disease resistance protein [Medicag... 54 1e-06 XP_013458961.1 LRR and NB-ARC domain disease resistance protein ... 54 1e-06 XP_003598466.1 LRR and NB-ARC domain disease resistance protein ... 54 1e-06 XP_003598470.1 LRR and NB-ARC domain disease resistance protein ... 54 1e-06 XP_003598501.1 LRR and NB-ARC domain disease resistance protein ... 53 4e-06 KYP59764.1 Putative disease resistance RPP13-like protein 1 [Caj... 52 5e-06 KYP41963.1 Putative disease resistance RPP13-like protein 1 [Caj... 52 5e-06 XP_013442215.1 NB-ARC domain disease resistance protein, putativ... 50 8e-06 XP_003598489.1 LRR and NB-ARC domain disease resistance protein ... 52 9e-06 XP_003598494.2 LRR and NB-ARC domain disease resistance protein ... 52 9e-06 >KYP41066.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1173 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLKS 146 VSGSVW GTPTSSVVDES+I GRD D+KKLK+ Sbjct: 153 VSGSVWHGTPTSSVVDESTIYGRDGDRKKLKN 184 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -2 Query: 164 QKET*EYLLSEDAXXXXXXXXXXXXXXXXXXXXXXXXXXLYNDPEVEKKFHLKA 3 +K+ YL+SEDA LYND +V++KF LKA Sbjct: 179 RKKLKNYLMSEDASGSGCKIGVISIVGMGGLGKTTLAKLLYNDRDVQEKFDLKA 232 >KYP41054.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 993 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLKS 146 VSGSVW GTPTSSVVDES+I GRD D+KKLK+ Sbjct: 153 VSGSVWHGTPTSSVVDESTIYGRDGDRKKLKN 184 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -2 Query: 164 QKET*EYLLSEDAXXXXXXXXXXXXXXXXXXXXXXXXXXLYNDPEVEKKFHLKA 3 +K+ YL+SEDA LYND +V++KF LKA Sbjct: 179 RKKLKNYLMSEDASGSGCKIGVISIVGMGGLGKTTLAKLLYNDRDVQEKFDLKA 232 >GAU39699.1 hypothetical protein TSUD_321120 [Trifolium subterraneum] Length = 230 Score = 54.3 bits (129), Expect = 7e-07 Identities = 28/32 (87%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VSGSVW GTPTSSVV DES+I GRDDDKKKLK Sbjct: 150 VSGSVWLGTPTSSVVGDESAIYGRDDDKKKLK 181 >XP_016182307.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Arachis ipaensis] XP_016182308.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Arachis ipaensis] Length = 1104 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLK 149 VS SVWQG PTSSVVDES I GRDD++KKL+ Sbjct: 153 VSNSVWQGMPTSSVVDESVIYGRDDERKKLR 183 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -2 Query: 164 QKET*EYLLSEDAXXXXXXXXXXXXXXXXXXXXXXXXXXLYNDPEVEKKFHLKA 3 +K+ EYLLSED LYND EV+ KF LKA Sbjct: 179 RKKLREYLLSEDVGASGNKIGVISIVGMGGIGKTTIAKLLYNDDEVKDKFDLKA 232 >XP_013466896.1 NB-ARC domain disease resistance protein [Medicago truncatula] KEH40937.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 376 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VS S+W G PTSSVV DESSICGRDD+KKKLK Sbjct: 153 VSNSIWYGNPTSSVVVDESSICGRDDEKKKLK 184 >XP_013458961.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] KEH33003.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1212 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLKSICCQK 131 V G VW G PTSSVVDES+I GRDDD+KKLK K Sbjct: 152 VCGKVWHGIPTSSVVDESAIYGRDDDRKKLKEFLLSK 188 >XP_003598466.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68717.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1216 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VS S+W G PTSSVV DESSICGRDD+KKKLK Sbjct: 153 VSNSIWYGNPTSSVVVDESSICGRDDEKKKLK 184 >XP_003598470.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68721.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1247 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLKSICCQK 131 V G VW G PTSSVVDES+I GRDDD+KKLK K Sbjct: 152 VCGKVWHGIPTSSVVDESAIYGRDDDRKKLKEFLLSK 188 >XP_003598501.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68752.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 829 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VS SVW GTPTSSVV DES+I GRDDDKKKLK Sbjct: 148 VSNSVWHGTPTSSVVGDESAIYGRDDDKKKLK 179 >KYP59764.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1060 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLK 149 VS VW GTPTSSVVDES+I GRDDDKK LK Sbjct: 153 VSSRVWHGTPTSSVVDESAIYGRDDDKKILK 183 >KYP41963.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1071 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLK 149 VS SVW GTPTSSVVDES+I GRD D+K+LK Sbjct: 148 VSSSVWHGTPTSSVVDESTISGRDGDRKELK 178 >XP_013442215.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] KEH16240.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 1982 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 241 VSGSVWQGTPTSSVVDESSICGRDDDKKKLKSI 143 VS SVW GTPTSSV+DES+I GRD D+KKL+ + Sbjct: 142 VSCSVWNGTPTSSVLDESAIYGRDGDRKKLQEL 174 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 44 YNDPEVEKKFHLK 6 YNDPEV++KF LK Sbjct: 206 YNDPEVKEKFDLK 218 >XP_003598489.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68740.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1342 Score = 51.6 bits (122), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VS +VW GTPTSSVV DES+I GRDDDKKKLK Sbjct: 149 VSSNVWHGTPTSSVVGDESAIYGRDDDKKKLK 180 >XP_003598494.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68745.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1354 Score = 51.6 bits (122), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -3 Query: 241 VSGSVWQGTPTSSVV-DESSICGRDDDKKKLK 149 VS SVW GTPTSSVV DES+I GRDDD+KKLK Sbjct: 148 VSNSVWHGTPTSSVVGDESAIYGRDDDRKKLK 179