BLASTX nr result
ID: Glycyrrhiza36_contig00019291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00019291 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35254.1 hypothetical protein TSUD_323910 [Trifolium subterran... 57 7e-08 >GAU35254.1 hypothetical protein TSUD_323910 [Trifolium subterraneum] Length = 89 Score = 56.6 bits (135), Expect = 7e-08 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 3/52 (5%) Frame = -2 Query: 440 TLENGI---PKVTSCIKDAESNLRSPSISMAVEQVALEMVEENTGTIKEDLN 294 TL+NG+ + SC+KDA+ +L SPS SMAVEQ+A+ ++ EN GTIKED+N Sbjct: 31 TLQNGVNDASEAISCMKDADRHLSSPSTSMAVEQIAI-LIVENAGTIKEDVN 81