BLASTX nr result
ID: Glycyrrhiza36_contig00019049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00019049 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016165509.1 PREDICTED: uncharacterized protein LOC107608141 [... 125 1e-31 XP_015973738.1 PREDICTED: uncharacterized protein LOC107496928 [... 125 1e-31 AFK40645.1 unknown [Lotus japonicus] 117 4e-31 GAU18148.1 hypothetical protein TSUD_248490 [Trifolium subterran... 117 5e-31 KHN38553.1 hypothetical protein glysoja_004218 [Glycine soja] 122 9e-31 XP_004491000.1 PREDICTED: uncharacterized protein LOC101506372 [... 122 9e-31 XP_003518418.1 PREDICTED: uncharacterized protein LOC100782905 [... 122 9e-31 KHN44714.1 hypothetical protein glysoja_032053 [Glycine soja] 122 9e-31 XP_003545215.1 PREDICTED: uncharacterized protein LOC100809574 [... 122 9e-31 XP_003616715.1 hypothetical protein MTR_5g083500 [Medicago trunc... 121 2e-30 XP_019459613.1 PREDICTED: uncharacterized protein LOC109359417 [... 121 2e-30 KYP73104.1 hypothetical protein KK1_005717 [Cajanus cajan] 120 4e-30 XP_017429703.1 PREDICTED: uncharacterized protein LOC108337645 [... 119 2e-29 EOY17656.1 Neuronal PAS domain-containing protein 4 [Theobroma c... 119 2e-29 XP_007141723.1 hypothetical protein PHAVU_008G219800g [Phaseolus... 118 4e-29 KHN25988.1 hypothetical protein glysoja_050267 [Glycine soja] 117 1e-28 KRH31196.1 hypothetical protein GLYMA_11G233600 [Glycine max] 117 1e-28 XP_017984485.1 PREDICTED: uncharacterized protein LOC18585782 [T... 116 2e-28 OIV97442.1 hypothetical protein TanjilG_16203 [Lupinus angustifo... 110 3e-28 XP_014502982.1 PREDICTED: uncharacterized protein LOC106763292 [... 115 6e-28 >XP_016165509.1 PREDICTED: uncharacterized protein LOC107608141 [Arachis ipaensis] Length = 511 Score = 125 bits (314), Expect = 1e-31 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDKGA GKTMEWEIRGWIW+TYWPNKYKTFY ETRRLEFREI+H+NI Sbjct: 453 GDEYGESVCWKVDKGAKGKTMEWEIRGWIWVTYWPNKYKTFYDETRRLEFREILHVNI 510 >XP_015973738.1 PREDICTED: uncharacterized protein LOC107496928 [Arachis duranensis] Length = 515 Score = 125 bits (314), Expect = 1e-31 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDKGA GKTMEWEIRGWIW+TYWPNKYKTFY ETRRLEFREI+H+NI Sbjct: 457 GDEYGESVCWKVDKGAKGKTMEWEIRGWIWVTYWPNKYKTFYDETRRLEFREILHVNI 514 >AFK40645.1 unknown [Lotus japonicus] Length = 201 Score = 117 bits (294), Expect = 4e-31 Identities = 51/58 (87%), Positives = 52/58 (89%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDK +GK MEW IRGWIWL Y PNKYKTFYHETRRLEFREIVHLNI Sbjct: 143 GDEYGESVCWKVDKSTIGKKMEWGIRGWIWLRYLPNKYKTFYHETRRLEFREIVHLNI 200 >GAU18148.1 hypothetical protein TSUD_248490 [Trifolium subterraneum] Length = 201 Score = 117 bits (293), Expect = 5e-31 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDK A GK MEWEIRGWIWLTY PN Y+TFYHETRRLEFREIV+LNI Sbjct: 143 GDEYGESVCWKVDKSARGKIMEWEIRGWIWLTYLPNNYRTFYHETRRLEFREIVYLNI 200 >KHN38553.1 hypothetical protein glysoja_004218 [Glycine soja] Length = 501 Score = 122 bits (307), Expect = 9e-31 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 6 DEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 DEYGESVCWKVDKGA+GKTMEWEIRGWIWLTYWPNK+KTFYHETRRLEFRE V+L I Sbjct: 444 DEYGESVCWKVDKGAVGKTMEWEIRGWIWLTYWPNKHKTFYHETRRLEFRETVYLKI 500 >XP_004491000.1 PREDICTED: uncharacterized protein LOC101506372 [Cicer arietinum] Length = 501 Score = 122 bits (307), Expect = 9e-31 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDK A GKTMEWEI+GWIWLTY PNKY+TFYHETRRLEFREIVHLNI Sbjct: 443 GDEYGESVCWKVDKNARGKTMEWEIKGWIWLTYLPNKYRTFYHETRRLEFREIVHLNI 500 >XP_003518418.1 PREDICTED: uncharacterized protein LOC100782905 [Glycine max] KRH73237.1 hypothetical protein GLYMA_02G261000 [Glycine max] Length = 501 Score = 122 bits (307), Expect = 9e-31 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +3 Query: 6 DEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 DEYGESVCWKVDKGA+GKTMEWEIRGWIWLTYWPNK+KTFYHETRRLEFRE V+L I Sbjct: 444 DEYGESVCWKVDKGAVGKTMEWEIRGWIWLTYWPNKHKTFYHETRRLEFRETVYLKI 500 >KHN44714.1 hypothetical protein glysoja_032053 [Glycine soja] Length = 502 Score = 122 bits (307), Expect = 9e-31 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDKGA+GKTMEWEIRGWIW+TYWPNK+KTFYHETRR EFRE V+L I Sbjct: 444 GDEYGESVCWKVDKGAVGKTMEWEIRGWIWITYWPNKHKTFYHETRRFEFRETVYLKI 501 >XP_003545215.1 PREDICTED: uncharacterized protein LOC100809574 [Glycine max] KRH14894.1 hypothetical protein GLYMA_14G055400 [Glycine max] Length = 502 Score = 122 bits (307), Expect = 9e-31 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDKGA+GKTMEWEIRGWIW+TYWPNK+KTFYHETRR EFRE V+L I Sbjct: 444 GDEYGESVCWKVDKGAVGKTMEWEIRGWIWITYWPNKHKTFYHETRRFEFRETVYLKI 501 >XP_003616715.1 hypothetical protein MTR_5g083500 [Medicago truncatula] AES99673.1 hypothetical protein MTR_5g083500 [Medicago truncatula] Length = 496 Score = 121 bits (304), Expect = 2e-30 Identities = 53/58 (91%), Positives = 54/58 (93%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDK A GK MEWEIRGWIWLTY PNKY+TFYHETRRLEFREIVHLNI Sbjct: 438 GDEYGESVCWKVDKSARGKIMEWEIRGWIWLTYLPNKYRTFYHETRRLEFREIVHLNI 495 >XP_019459613.1 PREDICTED: uncharacterized protein LOC109359417 [Lupinus angustifolius] OIW02741.1 hypothetical protein TanjilG_29517 [Lupinus angustifolius] Length = 500 Score = 121 bits (304), Expect = 2e-30 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGESVCWKVDK A+GKTMEWEIRGWIWLTY PNKY+TFY+ETRRLEF+EIVHLNI Sbjct: 442 GDEYGESVCWKVDKSAIGKTMEWEIRGWIWLTYLPNKYRTFYNETRRLEFKEIVHLNI 499 >KYP73104.1 hypothetical protein KK1_005717 [Cajanus cajan] Length = 497 Score = 120 bits (302), Expect = 4e-30 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = +3 Query: 6 DEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 DEYGESVCWKVDKGA+GKTMEWEIRGWIWLTYWPNK+ TFYHETRRLEFRE V+L I Sbjct: 440 DEYGESVCWKVDKGAVGKTMEWEIRGWIWLTYWPNKHNTFYHETRRLEFRETVYLKI 496 >XP_017429703.1 PREDICTED: uncharacterized protein LOC108337645 [Vigna angularis] KOM46859.1 hypothetical protein LR48_Vigan07g056300 [Vigna angularis] BAT81072.1 hypothetical protein VIGAN_03072800 [Vigna angularis var. angularis] Length = 500 Score = 119 bits (298), Expect = 2e-29 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = +3 Query: 6 DEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 DEYGESVCWKVDKG +GKTMEWE+RGWIWLTYWPNK+KTFYHET+R +FRE V+LNI Sbjct: 444 DEYGESVCWKVDKGVVGKTMEWEVRGWIWLTYWPNKHKTFYHETKRFDFRETVYLNI 500 >EOY17656.1 Neuronal PAS domain-containing protein 4 [Theobroma cacao] Length = 498 Score = 119 bits (297), Expect = 2e-29 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE V WKVDK A+GKTMEWEIRGWIWLTYWPNK++TFY+ETRRLEFREI+HLNI Sbjct: 440 GDEYGEKVWWKVDKSAMGKTMEWEIRGWIWLTYWPNKHRTFYNETRRLEFREILHLNI 497 >XP_007141723.1 hypothetical protein PHAVU_008G219800g [Phaseolus vulgaris] ESW13717.1 hypothetical protein PHAVU_008G219800g [Phaseolus vulgaris] Length = 501 Score = 118 bits (295), Expect = 4e-29 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE VCWKVDKG +GKTMEWE+RGWIWLTYWPNKYKTFYHET+R +F+E V+L I Sbjct: 443 GDEYGERVCWKVDKGVVGKTMEWEVRGWIWLTYWPNKYKTFYHETKRFQFKETVYLKI 500 >KHN25988.1 hypothetical protein glysoja_050267 [Glycine soja] Length = 487 Score = 117 bits (292), Expect = 1e-28 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE V WKVDKGA+GKTMEWEIRGWIWLTYWPNK TFY+ETRRLEFREIVHL++ Sbjct: 429 GDEYGEKVWWKVDKGAIGKTMEWEIRGWIWLTYWPNKRVTFYNETRRLEFREIVHLDV 486 >KRH31196.1 hypothetical protein GLYMA_11G233600 [Glycine max] Length = 497 Score = 117 bits (292), Expect = 1e-28 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE V WKVDKGA+GKTMEWEIRGWIWLTYWPNK TFY+ETRRLEFREIVHL++ Sbjct: 439 GDEYGEKVWWKVDKGAIGKTMEWEIRGWIWLTYWPNKRVTFYNETRRLEFREIVHLDV 496 >XP_017984485.1 PREDICTED: uncharacterized protein LOC18585782 [Theobroma cacao] Length = 498 Score = 116 bits (291), Expect = 2e-28 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE V WKVDK A+GKTMEWEIRGWIWLTYWPNK++TFY+ETR LEFREI+HLNI Sbjct: 440 GDEYGEKVWWKVDKSAMGKTMEWEIRGWIWLTYWPNKHRTFYNETRSLEFREILHLNI 497 >OIV97442.1 hypothetical protein TanjilG_16203 [Lupinus angustifolius] Length = 200 Score = 110 bits (275), Expect = 3e-28 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = +3 Query: 3 GDEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 GDEYGE V WKVDK A+G TME+EIRGWIWLTY PNK+ TFYHETRRLEFREIVHLN+ Sbjct: 142 GDEYGEGVSWKVDKDAIGNTMEFEIRGWIWLTYLPNKHATFYHETRRLEFREIVHLNV 199 >XP_014502982.1 PREDICTED: uncharacterized protein LOC106763292 [Vigna radiata var. radiata] Length = 500 Score = 115 bits (287), Expect = 6e-28 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +3 Query: 6 DEYGESVCWKVDKGALGKTMEWEIRGWIWLTYWPNKYKTFYHETRRLEFREIVHLNI 176 DEYGESVCWKVDKG +GK MEWE+RGWIWLTYWPNK+KTFYHET+R +FRE V+L+I Sbjct: 444 DEYGESVCWKVDKGVVGKMMEWEVRGWIWLTYWPNKHKTFYHETKRFDFRETVYLSI 500