BLASTX nr result
ID: Glycyrrhiza36_contig00018914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00018914 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [J... 103 1e-26 CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g2931... 43 4e-07 CDY72580.1 BnaCnng78410D, partial [Brassica napus] 43 4e-07 >YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [Jatropha curcas] ACN72735.1 ORF126 (chloroplast) [Jatropha curcas] ACN72751.1 ORF126 (chloroplast) [Jatropha curcas] Length = 126 Score = 103 bits (257), Expect = 1e-26 Identities = 51/76 (67%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = -2 Query: 279 DTIETSVKMPNHKPTDKVHYIVRFRDWRLTHSMPLVPDIPPHGY-SRGRVNSIIDAC*HS 103 DTIETS KMP PTDKVHYIVRFRDWRLTHS+ L D+P + GRVNSIID C HS Sbjct: 29 DTIETSGKMPARNPTDKVHYIVRFRDWRLTHSVTLALDVPKRKWVLSGRVNSIIDVCWHS 88 Query: 102 NLSSPFRVYPKRKRIL 55 +L SPFR YPK +L Sbjct: 89 SLPSPFRAYPKENPVL 104 >CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g29310D [Brassica napus] CDX95211.1 BnaC09g16590D [Brassica napus] Length = 148 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 141 GRVNSIIDAC*HSNLSSPFRVYPKRKRIL 55 GRVNSIIDA HS+L SPFR YPK+ +L Sbjct: 98 GRVNSIIDAWRHSSLPSPFRTYPKQNPVL 126 Score = 38.1 bits (87), Expect(2) = 4e-07 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 67 KENSVLIGHEYLNRTNHSADLF 2 K+N VL+G EYLNR NHS D+F Sbjct: 121 KQNPVLLGREYLNRANHSVDIF 142 >CDY72580.1 BnaCnng78410D, partial [Brassica napus] Length = 74 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 141 GRVNSIIDAC*HSNLSSPFRVYPKRKRIL 55 GRVNSIIDA HS+L SPFR YPK+ +L Sbjct: 24 GRVNSIIDAWRHSSLPSPFRTYPKQNPVL 52 Score = 38.1 bits (87), Expect(2) = 4e-07 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 67 KENSVLIGHEYLNRTNHSADLF 2 K+N VL+G EYLNR NHS D+F Sbjct: 47 KQNPVLLGREYLNRANHSVDIF 68