BLASTX nr result
ID: Glycyrrhiza36_contig00017774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00017774 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004491445.1 PREDICTED: protein ENHANCED DOWNY MILDEW 2-like i... 64 2e-10 XP_004491444.1 PREDICTED: protein ENHANCED DOWNY MILDEW 2-like i... 64 2e-10 >XP_004491445.1 PREDICTED: protein ENHANCED DOWNY MILDEW 2-like isoform X2 [Cicer arietinum] XP_012568672.1 PREDICTED: protein ENHANCED DOWNY MILDEW 2-like isoform X2 [Cicer arietinum] Length = 953 Score = 64.3 bits (155), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 62 MNSGSHTSIKLKSNEISRC-LTGNKKSISKKFKMADCEENMPLIEEKSCAVMNK 220 M SGSH S K KSNEISR LT NKKSISKKF+M +CEEN L EK CA M+K Sbjct: 577 MISGSHISKKTKSNEISRRPLTENKKSISKKFEMPNCEENNHLTGEKLCAPMDK 630 >XP_004491444.1 PREDICTED: protein ENHANCED DOWNY MILDEW 2-like isoform X1 [Cicer arietinum] Length = 975 Score = 64.3 bits (155), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 62 MNSGSHTSIKLKSNEISRC-LTGNKKSISKKFKMADCEENMPLIEEKSCAVMNK 220 M SGSH S K KSNEISR LT NKKSISKKF+M +CEEN L EK CA M+K Sbjct: 599 MISGSHISKKTKSNEISRRPLTENKKSISKKFEMPNCEENNHLTGEKLCAPMDK 652