BLASTX nr result
ID: Glycyrrhiza36_contig00017045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00017045 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM52691.1 hypothetical protein LR48_Vigan09g135000 [Vigna angul... 56 1e-07 XP_017436605.1 PREDICTED: uncharacterized protein LOC108343070 [... 56 1e-07 XP_006282283.1 hypothetical protein CARUB_v10028567mg, partial [... 52 3e-06 XP_018828616.1 PREDICTED: uncharacterized protein LOC108996998 [... 50 6e-06 XP_002269081.1 PREDICTED: uncharacterized protein LOC100267277 [... 50 7e-06 XP_003553225.1 PREDICTED: uncharacterized protein LOC100306619 [... 50 8e-06 OIW21904.1 hypothetical protein TanjilG_14549 [Lupinus angustifo... 50 8e-06 XP_008243677.1 PREDICTED: uncharacterized protein LOC103341870 [... 50 8e-06 XP_007206190.1 hypothetical protein PRUPE_ppa014033mg [Prunus pe... 50 8e-06 GAU36840.1 hypothetical protein TSUD_213640 [Trifolium subterran... 50 8e-06 XP_003616005.1 methyltransferase-like protein [Medicago truncatu... 50 8e-06 GAU36838.1 hypothetical protein TSUD_213620 [Trifolium subterran... 50 8e-06 XP_015874607.1 PREDICTED: uncharacterized protein LOC107411522 [... 50 9e-06 EYU46005.1 hypothetical protein MIMGU_mgv1a023921mg, partial [Er... 50 9e-06 >KOM52691.1 hypothetical protein LR48_Vigan09g135000 [Vigna angularis] Length = 128 Score = 55.8 bits (133), Expect = 1e-07 Identities = 33/60 (55%), Positives = 38/60 (63%) Frame = +1 Query: 136 IPFVSWV*LCLHIHTNVFFSITFFREGIERKNKQTIMCPLRLILIFLSATLAGFFVLRNL 315 I FVSWV C HT F+ I + ++ MCPLR IL+FLSATLAGFFVLRNL Sbjct: 10 IAFVSWVQECAP-HTRAIFN------HILLSSSESKMCPLRFILVFLSATLAGFFVLRNL 62 >XP_017436605.1 PREDICTED: uncharacterized protein LOC108343070 [Vigna angularis] Length = 130 Score = 55.8 bits (133), Expect = 1e-07 Identities = 33/60 (55%), Positives = 38/60 (63%) Frame = +1 Query: 136 IPFVSWV*LCLHIHTNVFFSITFFREGIERKNKQTIMCPLRLILIFLSATLAGFFVLRNL 315 I FVSWV C HT F+ I + ++ MCPLR IL+FLSATLAGFFVLRNL Sbjct: 10 IAFVSWVQECAP-HTRAIFN------HILLSSSESKMCPLRFILVFLSATLAGFFVLRNL 62 >XP_006282283.1 hypothetical protein CARUB_v10028567mg, partial [Capsella rubella] EOA15181.1 hypothetical protein CARUB_v10028567mg, partial [Capsella rubella] Length = 128 Score = 52.0 bits (123), Expect = 3e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 211 EGIERKNKQTIMCPLRLILIFLSATLAGFFVLRNL 315 E RK K+ MCPLRLILIFLSATLAGFFVL+ L Sbjct: 33 ESKSRKGKKKQMCPLRLILIFLSATLAGFFVLKKL 67 >XP_018828616.1 PREDICTED: uncharacterized protein LOC108996998 [Juglans regia] Length = 81 Score = 50.1 bits (118), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_002269081.1 PREDICTED: uncharacterized protein LOC100267277 [Vitis vinifera] Length = 87 Score = 50.1 bits (118), Expect = 7e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_003553225.1 PREDICTED: uncharacterized protein LOC100306619 [Glycine max] ACU14894.1 unknown [Glycine max] KRG98169.1 hypothetical protein GLYMA_18G054800 [Glycine max] Length = 89 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >OIW21904.1 hypothetical protein TanjilG_14549 [Lupinus angustifolius] Length = 90 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_008243677.1 PREDICTED: uncharacterized protein LOC103341870 [Prunus mume] Length = 90 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_007206190.1 hypothetical protein PRUPE_ppa014033mg [Prunus persica] ONH99686.1 hypothetical protein PRUPE_6G043500 [Prunus persica] Length = 90 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >GAU36840.1 hypothetical protein TSUD_213640 [Trifolium subterraneum] Length = 91 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_003616005.1 methyltransferase-like protein [Medicago truncatula] AES98963.1 methyltransferase-like protein [Medicago truncatula] Length = 91 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >GAU36838.1 hypothetical protein TSUD_213620 [Trifolium subterraneum] Length = 92 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >XP_015874607.1 PREDICTED: uncharacterized protein LOC107411522 [Ziziphus jujuba] Length = 97 Score = 50.1 bits (118), Expect = 9e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 244 MCPLRLILIFLSATLAGFFVLRNL 315 MCPLRLILIFLSATLAGFFVLRNL Sbjct: 1 MCPLRLILIFLSATLAGFFVLRNL 24 >EYU46005.1 hypothetical protein MIMGU_mgv1a023921mg, partial [Erythranthe guttata] Length = 99 Score = 50.1 bits (118), Expect = 9e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 226 KNKQTIMCPLRLILIFLSATLAGFFVLRNL 315 + + + MCPLR+ILIFLSATLAGFFVLRNL Sbjct: 3 RERNSEMCPLRIILIFLSATLAGFFVLRNL 32