BLASTX nr result
ID: Glycyrrhiza36_contig00016936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00016936 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF27381.1 conserved hypothetical protein [Ricinus communis] 60 8e-09 >EEF27381.1 conserved hypothetical protein [Ricinus communis] Length = 141 Score = 59.7 bits (143), Expect = 8e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 22 KRGNENPFPIAFDSHWNGTPSTSSLKSETVLIS 120 KRG+ENPFPIAFDSHWNGT S S LKS+TV IS Sbjct: 108 KRGDENPFPIAFDSHWNGTSSASPLKSDTVPIS 140