BLASTX nr result
ID: Glycyrrhiza36_contig00016526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00016526 (832 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterran... 47 1e-10 XP_013442442.1 telomerase activating protein Est1 [Medicago trun... 63 2e-07 >GAU32809.1 hypothetical protein TSUD_152580 [Trifolium subterraneum] Length = 996 Score = 47.4 bits (111), Expect(2) = 1e-10 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 17 YCECAASFCYWFKLHLCCLVIGC 85 YC+CAASFCY FKL LC LVIGC Sbjct: 945 YCKCAASFCYSFKLQLCSLVIGC 967 Score = 47.4 bits (111), Expect(2) = 1e-10 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +3 Query: 69 ALLLDVCWSFFGLDLLQAVASTKDFAELFS 158 +L++ CWS FGLDLLQ +A+TKD+AELFS Sbjct: 962 SLVIGCCWSSFGLDLLQDIATTKDYAELFS 991 >XP_013442442.1 telomerase activating protein Est1 [Medicago truncatula] KEH16467.1 telomerase activating protein Est1 [Medicago truncatula] Length = 1040 Score = 62.8 bits (151), Expect = 2e-07 Identities = 36/66 (54%), Positives = 40/66 (60%) Frame = +2 Query: 17 YCECAASFCYWFKLHLCCLVIGCLLEFLWP*LVAGCCFYKRFC*ALQQARIKEDKQASLQ 196 YC AASFCY FKL LC LVIGC L+ K + + QAR KEDKQASLQ Sbjct: 976 YCGWAASFCYSFKLQLCGLVIGCCWSSFGLDLLQDVATTKDYA-EVSQARTKEDKQASLQ 1034 Query: 197 FKIRKK 214 FK+ KK Sbjct: 1035 FKVLKK 1040