BLASTX nr result
ID: Glycyrrhiza36_contig00016228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00016228 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU16167.1 unknown, partial [Glycine max] 66 5e-12 XP_006596465.1 PREDICTED: uncharacterized protein LOC100816328 i... 53 9e-06 >ACU16167.1 unknown, partial [Glycine max] Length = 105 Score = 66.2 bits (160), Expect = 5e-12 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +3 Query: 162 SSEGLLTKYYHRRLHNVKETTTVHVSRGHHQGNLSGHGLHQRYCFWDPLQT 314 S++ + T++YH LHN K TT HVSRGHH GNL+GHGLHQR+ FW+ L T Sbjct: 50 STKPMSTQHYHYELHN-KMNTTTHVSRGHHHGNLNGHGLHQRH-FWNQLLT 98 >XP_006596465.1 PREDICTED: uncharacterized protein LOC100816328 isoform X1 [Glycine max] Length = 781 Score = 52.8 bits (125), Expect = 9e-06 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 312 SVVDPKSNIFDGVHGHSNCLDDAPEKH 232 SVVD KS++F GVHGHSNC DDAPEKH Sbjct: 754 SVVDSKSSVFGGVHGHSNCRDDAPEKH 780