BLASTX nr result
ID: Glycyrrhiza36_contig00016145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00016145 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572412.1 PREDICTED: L-type lectin-domain containing recept... 61 3e-08 >XP_012572412.1 PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cicer arietinum] Length = 668 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +2 Query: 224 YVRITFLFLLIIPPANAEPQSFNFPYFSHINVEQQQLYLEGNA 352 Y ITFLFLLIIP N++ QSFNFPYFS +NV Q+ LEGNA Sbjct: 5 YESITFLFLLIIPLTNSKSQSFNFPYFSQMNVNLNQIKLEGNA 47