BLASTX nr result
ID: Glycyrrhiza36_contig00014975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00014975 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004515282.1 PREDICTED: probable metal-nicotianamine transport... 57 5e-07 >XP_004515282.1 PREDICTED: probable metal-nicotianamine transporter YSL7 [Cicer arietinum] Length = 709 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 130 KEEEEGAASVEKVFQHLLVPSWRNQLTVRA 41 K+EEE AASVEKVF+HLLVPSWRNQLT+RA Sbjct: 40 KKEEEEAASVEKVFKHLLVPSWRNQLTIRA 69