BLASTX nr result
ID: Glycyrrhiza36_contig00014624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00014624 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM30480.1 hypothetical protein LR48_Vigan01g003400 [Vigna angul... 56 3e-07 >KOM30480.1 hypothetical protein LR48_Vigan01g003400 [Vigna angularis] Length = 969 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = +2 Query: 2 VHSTTTPFPNKNRATFPRPSRQTPLRTPSNPYSTSANA 115 VHS TTPFPNKN ATFP PSRQT L SN S S NA Sbjct: 12 VHSKTTPFPNKNSATFPPPSRQTALHASSNNSSASVNA 49