BLASTX nr result
ID: Glycyrrhiza36_contig00014013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00014013 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAO47202.1 hypothetical protein G7K_1412-t1 [Saitoella complicat... 114 5e-30 KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibu... 94 6e-24 WP_029467737.1 hypothetical protein [Hungatella hathewayi] 86 8e-20 AQP33833.1 hypothetical protein PN49_13035 [Vibrio anguillarum] 79 3e-17 OCK86501.1 hypothetical protein K441DRAFT_93587 [Cenococcum geop... 76 1e-16 KNA06142.1 hypothetical protein SOVF_183600 [Spinacia oleracea] 75 4e-16 OJJ66804.1 hypothetical protein ASPBRDRAFT_366689 [Aspergillus b... 68 2e-13 OCL10867.1 hypothetical protein AOQ84DRAFT_396602 [Glonium stell... 67 6e-13 OJJ41968.1 hypothetical protein ASPZODRAFT_1284245 [Penicilliops... 66 1e-12 CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] 64 3e-12 XP_018060498.1 hypothetical protein LY89DRAFT_703091 [Phialoceph... 65 4e-12 XP_013946733.1 hypothetical protein TRIATDRAFT_255346 [Trichoder... 62 3e-11 KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Lacca... 63 7e-11 KII82787.1 hypothetical protein PLICRDRAFT_58628 [Plicaturopsis ... 62 8e-11 OCH94923.1 hypothetical protein OBBRIDRAFT_705583, partial [Obba... 61 9e-11 KDQ49122.1 hypothetical protein JAAARDRAFT_143838, partial [Jaap... 62 1e-10 XP_007371709.1 hypothetical protein DICSQDRAFT_73523, partial [D... 61 1e-10 KIK49844.1 hypothetical protein GYMLUDRAFT_183501, partial [Gymn... 61 2e-10 ODV97872.1 hypothetical protein PACTADRAFT_371 [Pachysolen tanno... 43 9e-10 EGN91453.1 hypothetical protein SERLA73DRAFT_67379, partial [Ser... 57 5e-09 >GAO47202.1 hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 114 bits (286), Expect = 5e-30 Identities = 57/84 (67%), Positives = 61/84 (72%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHAAP 91 PPT+PINHYGGPRNQQNRT RPILLFHANVFEQ PALNTLIFS Sbjct: 78 PPTIPINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFSN---------------- 121 Query: 90 QKERPGRTSTRGEADRPARPKVQL 19 QKERPGR S+ EADRP RPK++L Sbjct: 122 QKERPGRVSSHREADRPTRPKLEL 145 >KZP03156.1 hypothetical protein FIBSPDRAFT_505248, partial [Fibulorhizoctonia sp. CBS 109695] Length = 50 Score = 94.4 bits (233), Expect = 6e-24 Identities = 42/49 (85%), Positives = 42/49 (85%) Frame = +2 Query: 98 ACPSLGVSGNQDFYFEKIRVFKAGLCSNTLAWNNRIGRAVLFCWFLGPP 244 ACP LG SGNQDFY EKIRVFKAGLC NTLAWNN IGRAVLFCWFL P Sbjct: 2 ACPLLGASGNQDFYLEKIRVFKAGLCPNTLAWNNEIGRAVLFCWFLESP 50 >WP_029467737.1 hypothetical protein [Hungatella hathewayi] Length = 130 Score = 86.3 bits (212), Expect = 8e-20 Identities = 46/78 (58%), Positives = 49/78 (62%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHAAP 91 PPTVPINHY GPRNQQNRT RPILLFHAN+FEQ F K K P +G A Sbjct: 2 PPTVPINHYDGPRNQQNRTKRPILLFHANIFEQYACFEHSNFFKVKVLVHQGP-QGPRAS 60 Query: 90 QKERPGRTSTRGEADRPA 37 QKERPGR + E PA Sbjct: 61 QKERPGRKNQYAEKSGPA 78 Score = 64.7 bits (156), Expect = 2e-11 Identities = 34/56 (60%), Positives = 36/56 (64%) Frame = -1 Query: 169 ACFEHSNFFKVKVLVPRHAQ*RACGSPEGKARPDQYTR*GGPASQAQGSTTSFLTA 2 ACFEHSNFFKVKVLV + Q E R +QY GPA QAQ STTSFLTA Sbjct: 36 ACFEHSNFFKVKVLVHQGPQGPRASQKERPGRKNQYAEKSGPADQAQSSTTSFLTA 91 >AQP33833.1 hypothetical protein PN49_13035 [Vibrio anguillarum] Length = 89 Score = 78.6 bits (192), Expect = 3e-17 Identities = 45/82 (54%), Positives = 49/82 (59%), Gaps = 1/82 (1%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPDTPSEGHAAP 91 PPTVPINHY GPRNQQNRT RPILLFHAN+FEQ F K K P +G Sbjct: 2 PPTVPINHYDGPRNQQNRTKRPILLFHANIFEQYACFEHSNFFKVKVLVRQEP-QGLKVS 60 Query: 90 QKERP-GRTSTRGEADRPARPK 28 QKERP ++STR PK Sbjct: 61 QKERPRWKSSTRKNRTGQPGPK 82 >OCK86501.1 hypothetical protein K441DRAFT_93587 [Cenococcum geophilum 1.58] Length = 59 Score = 76.3 bits (186), Expect = 1e-16 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 101 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 3 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC Sbjct: 1 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 33 >KNA06142.1 hypothetical protein SOVF_183600 [Spinacia oleracea] Length = 59 Score = 74.7 bits (182), Expect = 4e-16 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 101 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 3 MR PRRKGPAGPVHAVRRTGQPGPRFNYELFNC Sbjct: 1 MRFPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 33 >OJJ66804.1 hypothetical protein ASPBRDRAFT_366689 [Aspergillus brasiliensis CBS 101740] Length = 59 Score = 67.8 bits (164), Expect = 2e-13 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 101 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 3 MR PRRKGPAGPV AVRRTGQP PRFNYELFNC Sbjct: 1 MRFPRRKGPAGPVLAVRRTGQPDPRFNYELFNC 33 >OCL10867.1 hypothetical protein AOQ84DRAFT_396602 [Glonium stellatum] Length = 68 Score = 67.0 bits (162), Expect = 6e-13 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPT+PINHYGGPRNQQNRTARPILLFHAN Sbjct: 2 PPTIPINHYGGPRNQQNRTARPILLFHAN 30 >OJJ41968.1 hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] Length = 59 Score = 65.9 bits (159), Expect = 1e-12 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 101 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFNC 3 M PRRKGPAGPV AVRRTGQP PRFNYELFNC Sbjct: 1 MEFPRRKGPAGPVLAVRRTGQPDPRFNYELFNC 33 >CQB88528.1 Uncharacterised protein [Chlamydia trachomatis] Length = 67 Score = 63.5 bits (153), Expect(2) = 3e-12 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 125 NQDFYFEKIRVFKAGLCSNTLAWNNRIGR 211 NQDFYFEKIRVFKAGLCSN LAWNNRIGR Sbjct: 3 NQDFYFEKIRVFKAGLCSNILAWNNRIGR 31 Score = 35.4 bits (80), Expect(2) = 3e-12 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +1 Query: 214 GSILLVSRTAVMINRDSRG 270 GSILLVSRT VMINRD RG Sbjct: 33 GSILLVSRTIVMINRDGRG 51 >XP_018060498.1 hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] KUJ06143.1 hypothetical protein LY89DRAFT_703091 [Phialocephala scopiformis] Length = 90 Score = 65.5 bits (158), Expect = 4e-12 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPT+PINHYGGPRNQQNRT RPILLFHAN Sbjct: 24 PPTIPINHYGGPRNQQNRTTRPILLFHAN 52 >XP_013946733.1 hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] EHK48568.1 hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 62.4 bits (150), Expect = 3e-11 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 101 MRLPRRKGPAGPVHAVRRTGQPGPRFNYELFN 6 M R KGPAGPVHAVRRTGQPGPRFNYELFN Sbjct: 1 MGFRRGKGPAGPVHAVRRTGQPGPRFNYELFN 32 >KIJ93785.1 hypothetical protein K443DRAFT_377952, partial [Laccaria amethystina LaAM-08-1] Length = 117 Score = 63.2 bits (152), Expect = 7e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 122 GNQDFYFEKIRVFKAGLCSNTLAWNNRIGRAV 217 GNQDFY EKIRVFKAG+C NTLAWNN+IGR V Sbjct: 72 GNQDFYLEKIRVFKAGICPNTLAWNNKIGRIV 103 >KII82787.1 hypothetical protein PLICRDRAFT_58628 [Plicaturopsis crispa FD-325 SS-3] Length = 64 Score = 61.6 bits (148), Expect = 8e-11 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPTVPINHYG RNQQNRTARPILLFHAN Sbjct: 2 PPTVPINHYGDSRNQQNRTARPILLFHAN 30 >OCH94923.1 hypothetical protein OBBRIDRAFT_705583, partial [Obba rivulosa] Length = 57 Score = 61.2 bits (147), Expect = 9e-11 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 4 PPTIPINHYGDSRNQQNRTARPILLFHAN 32 >KDQ49122.1 hypothetical protein JAAARDRAFT_143838, partial [Jaapia argillacea MUCL 33604] Length = 80 Score = 61.6 bits (148), Expect = 1e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPTVPINHYG RNQQNRTARPILLFHAN Sbjct: 18 PPTVPINHYGDSRNQQNRTARPILLFHAN 46 >XP_007371709.1 hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] EJF55554.1 hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 61.2 bits (147), Expect = 1e-10 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 4 PPTIPINHYGDSRNQQNRTARPILLFHAN 32 >KIK49844.1 hypothetical protein GYMLUDRAFT_183501, partial [Gymnopus luxurians FD-317 M1] Length = 79 Score = 61.2 bits (147), Expect = 2e-10 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 270 PPTVPINHYGGPRNQQNRTARPILLFHAN 184 PPT+PINHYG RNQQNRTARPILLFHAN Sbjct: 17 PPTIPINHYGDSRNQQNRTARPILLFHAN 45 >ODV97872.1 hypothetical protein PACTADRAFT_371 [Pachysolen tannophilus NRRL Y-2460] Length = 157 Score = 42.7 bits (99), Expect(3) = 9e-10 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 149 IRVFKAGLCSNTLAWNNRIGR 211 + VFKAGLCSN LAWNNRIGR Sbjct: 101 LAVFKAGLCSNILAWNNRIGR 121 Score = 35.4 bits (80), Expect(3) = 9e-10 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +1 Query: 214 GSILLVSRTAVMINRDSRG 270 GSILLVSRT VMINRD RG Sbjct: 123 GSILLVSRTIVMINRDGRG 141 Score = 31.6 bits (70), Expect(3) = 9e-10 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 3 AVKKLVVEPWAWLA 44 AVKKLVVEPW WLA Sbjct: 89 AVKKLVVEPWDWLA 102 >EGN91453.1 hypothetical protein SERLA73DRAFT_67379, partial [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 57.4 bits (137), Expect = 5e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 267 PTVPINHYGGPRNQQNRTARPILLFHAN 184 PTVPINHYG RNQQNRTA PILLFHAN Sbjct: 19 PTVPINHYGNSRNQQNRTAHPILLFHAN 46