BLASTX nr result
ID: Glycyrrhiza36_contig00013816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00013816 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AML79019.1 putative LOV domain-containing protein [Gompholobium ... 52 5e-06 >AML79019.1 putative LOV domain-containing protein [Gompholobium polymorphum] Length = 987 Score = 52.4 bits (124), Expect = 5e-06 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 20/78 (25%) Frame = +2 Query: 53 MEKVESYANYDPDARSDEAVG--IFKLPETQH---------EDAKRAAKVTSGSNMEP-- 193 MEK+E ANYDPD S + V +FKLPE+Q+ E + +A K+ GS + P Sbjct: 1 MEKLELSANYDPDTSSGQPVSSQVFKLPESQYVGQPSSRREEGSTKAVKLDGGSVIAPSS 60 Query: 194 -------VNKWMAFANKS 226 VN+WMAFA KS Sbjct: 61 SASGGESVNEWMAFARKS 78