BLASTX nr result
ID: Glycyrrhiza36_contig00013745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00013745 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU20384.1 unknown, partial [Glycine max] 64 3e-11 XP_016171331.1 PREDICTED: transcription factor TCP4-like [Arachi... 64 4e-10 XP_007149767.1 hypothetical protein PHAVU_005G097200g [Phaseolus... 64 5e-10 XP_015936317.1 PREDICTED: transcription factor TCP4-like [Arachi... 64 5e-10 XP_018824268.1 PREDICTED: transcription factor TCP4-like [Juglan... 64 5e-10 XP_004487176.1 PREDICTED: transcription factor TCP4-like [Cicer ... 64 5e-10 KHN27924.1 Transcription factor TCP4 [Glycine soja] 64 5e-10 XP_003540389.1 PREDICTED: transcription factor TCP4-like [Glycin... 64 5e-10 XP_003543311.1 PREDICTED: transcription factor TCP4 [Glycine max... 64 5e-10 XP_014522077.1 PREDICTED: transcription factor TCP4-like [Vigna ... 64 5e-10 XP_017425730.1 PREDICTED: transcription factor TCP4-like [Vigna ... 64 5e-10 XP_019458448.1 PREDICTED: transcription factor TCP4-like [Lupinu... 64 5e-10 KYP53316.1 Transcription factor TCP4 [Cajanus cajan] 64 5e-10 GAV75987.1 TCP domain-containing protein [Cephalotus follicularis] 64 7e-10 EOY13178.1 TCP family transcription factor 4, putative [Theobrom... 64 1e-09 XP_013465197.1 TCP family transcription factor [Medicago truncat... 63 1e-09 GAU27089.1 hypothetical protein TSUD_103980 [Trifolium subterran... 63 1e-09 XP_004303161.1 PREDICTED: transcription factor TCP4-like [Fragar... 62 2e-09 XP_007050039.1 PREDICTED: transcription factor TCP4 [Theobroma c... 62 3e-09 XP_011002677.1 PREDICTED: transcription factor TCP4-like [Populu... 62 4e-09 >ACU20384.1 unknown, partial [Glycine max] Length = 112 Score = 64.3 bits (155), Expect = 3e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_016171331.1 PREDICTED: transcription factor TCP4-like [Arachis ipaensis] XP_016171332.1 PREDICTED: transcription factor TCP4-like [Arachis ipaensis] XP_016171333.1 PREDICTED: transcription factor TCP4-like [Arachis ipaensis] Length = 312 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_007149767.1 hypothetical protein PHAVU_005G097200g [Phaseolus vulgaris] ESW21761.1 hypothetical protein PHAVU_005G097200g [Phaseolus vulgaris] Length = 330 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_015936317.1 PREDICTED: transcription factor TCP4-like [Arachis duranensis] Length = 332 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_018824268.1 PREDICTED: transcription factor TCP4-like [Juglans regia] XP_018824269.1 PREDICTED: transcription factor TCP4-like [Juglans regia] XP_018824270.1 PREDICTED: transcription factor TCP4-like [Juglans regia] Length = 335 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 7 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 36 >XP_004487176.1 PREDICTED: transcription factor TCP4-like [Cicer arietinum] XP_004487177.1 PREDICTED: transcription factor TCP4-like [Cicer arietinum] XP_004487178.1 PREDICTED: transcription factor TCP4-like [Cicer arietinum] XP_004487179.1 PREDICTED: transcription factor TCP4-like [Cicer arietinum] XP_004487180.1 PREDICTED: transcription factor TCP4-like [Cicer arietinum] Length = 339 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >KHN27924.1 Transcription factor TCP4 [Glycine soja] Length = 343 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_003540389.1 PREDICTED: transcription factor TCP4-like [Glycine max] KRH27017.1 hypothetical protein GLYMA_12G208800 [Glycine max] Length = 343 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_003543311.1 PREDICTED: transcription factor TCP4 [Glycine max] XP_006594827.1 PREDICTED: transcription factor TCP4 [Glycine max] XP_014621438.1 PREDICTED: transcription factor TCP4 [Glycine max] KHN36679.1 Transcription factor TCP4 [Glycine soja] KRH22307.1 hypothetical protein GLYMA_13G292500 [Glycine max] KRH22308.1 hypothetical protein GLYMA_13G292500 [Glycine max] KRH22309.1 hypothetical protein GLYMA_13G292500 [Glycine max] Length = 344 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_014522077.1 PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] XP_014522078.1 PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] XP_014522079.1 PREDICTED: transcription factor TCP4-like [Vigna radiata var. radiata] Length = 347 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_017425730.1 PREDICTED: transcription factor TCP4-like [Vigna angularis] XP_017425731.1 PREDICTED: transcription factor TCP4-like [Vigna angularis] XP_017425732.1 PREDICTED: transcription factor TCP4-like [Vigna angularis] KOM43760.1 hypothetical protein LR48_Vigan05g136500 [Vigna angularis] BAT92330.1 hypothetical protein VIGAN_07102700 [Vigna angularis var. angularis] Length = 347 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_019458448.1 PREDICTED: transcription factor TCP4-like [Lupinus angustifolius] XP_019458449.1 PREDICTED: transcription factor TCP4-like [Lupinus angustifolius] OIW03386.1 hypothetical protein TanjilG_31833 [Lupinus angustifolius] Length = 349 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >KYP53316.1 Transcription factor TCP4 [Cajanus cajan] Length = 411 Score = 64.3 bits (155), Expect = 5e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 30 >GAV75987.1 TCP domain-containing protein [Cephalotus follicularis] Length = 360 Score = 63.9 bits (154), Expect = 7e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHI+RSTGRKDRHSK Sbjct: 6 MGMKSTGGEIVQVQGGHIIRSTGRKDRHSK 35 >EOY13178.1 TCP family transcription factor 4, putative [Theobroma cacao] Length = 592 Score = 63.5 bits (153), Expect = 1e-09 Identities = 37/93 (39%), Positives = 47/93 (50%) Frame = +1 Query: 10 KQGHKKKKNLNLSGSHHHQPVHKNNKKTRTDFGGLYIHYLASNSTLHYTPDAGSTNTIEV 189 +QG + +L+ + K RT F S ST H S + Sbjct: 102 QQGQRLYASLDRQVIQQQEQESPQPPKKRTYFASSSSSAFGSKSTEHARTMGDSHHQAAT 161 Query: 190 LKGMGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 +G++ TGGEIV+VQGGHIVRSTGRKDRHSK Sbjct: 162 SSRLGIRHTGGEIVEVQGGHIVRSTGRKDRHSK 194 >XP_013465197.1 TCP family transcription factor [Medicago truncatula] KEH39232.1 TCP family transcription factor [Medicago truncatula] Length = 329 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVR+TGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRATGRKDRHSK 30 >GAU27089.1 hypothetical protein TSUD_103980 [Trifolium subterraneum] Length = 334 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKSTGGEIVQVQGGHIVR+TGRKDRHSK Sbjct: 1 MGMKSTGGEIVQVQGGHIVRATGRKDRHSK 30 >XP_004303161.1 PREDICTED: transcription factor TCP4-like [Fragaria vesca subsp. vesca] AQM52359.1 PCF transcription factor 13 [Fragaria vesca] Length = 366 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKS GGEIVQVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSVGGEIVQVQGGHIVRSTGRKDRHSK 30 >XP_007050039.1 PREDICTED: transcription factor TCP4 [Theobroma cacao] EOX94195.1 TCP family transcription factor 4 isoform 1 [Theobroma cacao] EOX94196.1 TCP family transcription factor 4 isoform 1 [Theobroma cacao] Length = 346 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKS GGEIVQVQGGHI+RSTGRKDRHSK Sbjct: 1 MGMKSVGGEIVQVQGGHIIRSTGRKDRHSK 30 >XP_011002677.1 PREDICTED: transcription factor TCP4-like [Populus euphratica] Length = 346 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 199 MGMKSTGGEIVQVQGGHIVRSTGRKDRHSK 288 MGMKST GEI+QVQGGHIVRSTGRKDRHSK Sbjct: 1 MGMKSTAGEIIQVQGGHIVRSTGRKDRHSK 30