BLASTX nr result
ID: Glycyrrhiza36_contig00012757
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00012757 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004492862.1 PREDICTED: peptide chain release factor PrfB1, ch... 51 8e-06 >XP_004492862.1 PREDICTED: peptide chain release factor PrfB1, chloroplastic [Cicer arietinum] Length = 461 Score = 51.2 bits (121), Expect = 8e-06 Identities = 31/63 (49%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 1 CKQPLLIPLYPTLSSSKHFPF-XXXXXXXXXXXXXXXXXXXXXENQLSVGEGEDTDTTEW 177 CKQPLLIP + + SSS HFPF ENQLSVGEGEDT T++ Sbjct: 22 CKQPLLIPKHLSPSSSTHFPFLSFRTTLSHRPSPPPPVLFATPENQLSVGEGEDTYTSDS 81 Query: 178 ALQ 186 ALQ Sbjct: 82 ALQ 84