BLASTX nr result
ID: Glycyrrhiza36_contig00012389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00012389 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013451295.1 hypothetical protein MTR_6g017300 [Medicago trunc... 74 1e-14 >XP_013451295.1 hypothetical protein MTR_6g017300 [Medicago truncatula] KEH25335.1 hypothetical protein MTR_6g017300 [Medicago truncatula] Length = 81 Score = 73.9 bits (180), Expect = 1e-14 Identities = 37/52 (71%), Positives = 39/52 (75%) Frame = +2 Query: 2 LRHTLDEITYMSVKWGRLHETVASL*STHEYQARARPKCATQR*HENCGGVV 157 L HTLD ITYMSVKWG LHETVA L STHEYQA ARP A R +NCG V+ Sbjct: 30 LYHTLDGITYMSVKWGCLHETVADLQSTHEYQAHARPISAQPRNSKNCGSVM 81