BLASTX nr result
ID: Glycyrrhiza36_contig00011654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00011654 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014627150.1 PREDICTED: AP2-like ethylene-responsive transcrip... 58 6e-08 XP_014491086.1 PREDICTED: ethylene-responsive transcription fact... 52 6e-06 >XP_014627150.1 PREDICTED: AP2-like ethylene-responsive transcription factor BBM1 [Glycine max] Length = 408 Score = 58.2 bits (139), Expect = 6e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREEE 268 VDRRHGKRP PSDHAS EER+ FNF + PSP KS+ EE Sbjct: 100 VDRRHGKRPFPSDHASREEREGFNFSV-LPSPPKSQGEE 137 >XP_014491086.1 PREDICTED: ethylene-responsive transcription factor ERF113-like [Vigna radiata var. radiata] Length = 291 Score = 52.4 bits (124), Expect = 6e-06 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = +2 Query: 152 VDRRHGKRPLPSDHASGEERKDFNFPIHYPSPSKSREE 265 VDRRHGKRPLPSDHAS E R+ FNF PS+ REE Sbjct: 16 VDRRHGKRPLPSDHASRENREGFNF------PSQQREE 47