BLASTX nr result
ID: Glycyrrhiza36_contig00011055
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00011055 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016201243.1 PREDICTED: acyl-CoA-binding protein [Arachis ipae... 61 3e-10 XP_015963178.1 PREDICTED: acyl-CoA-binding protein [Arachis dura... 60 5e-10 KQL09024.1 hypothetical protein SETIT_007643mg [Setaria italica] 60 6e-10 KQL09025.1 hypothetical protein SETIT_007643mg [Setaria italica] 60 7e-10 XP_006432817.1 hypothetical protein CICLE_v10002973mg [Citrus cl... 60 7e-10 XP_004512378.1 PREDICTED: acyl-CoA-binding protein isoform X3 [C... 60 7e-10 XP_004964355.1 PREDICTED: acyl-CoA-binding protein [Setaria ital... 60 8e-10 OIW10729.1 hypothetical protein TanjilG_27675 [Lupinus angustifo... 59 9e-10 XP_004512377.1 PREDICTED: acyl-CoA-binding protein isoform X1 [C... 60 1e-09 XP_017426560.1 PREDICTED: acyl-CoA-binding protein isoform X1 [V... 59 1e-09 XP_017426562.1 PREDICTED: acyl-CoA-binding protein isoform X2 [V... 59 1e-09 XP_002303469.1 acyl-CoA-binding family protein [Populus trichoca... 59 1e-09 XP_007158140.1 hypothetical protein PHAVU_002G127700g [Phaseolus... 59 1e-09 BAT99755.1 hypothetical protein VIGAN_10126700 [Vigna angularis ... 59 2e-09 XP_002519878.2 PREDICTED: acyl-CoA-binding protein [Ricinus comm... 59 2e-09 XP_006385713.1 hypothetical protein POPTR_0003s10270g [Populus t... 59 2e-09 XP_019445210.1 PREDICTED: acyl-CoA-binding protein-like [Lupinus... 59 2e-09 AFK47991.1 unknown [Lotus japonicus] 59 2e-09 XP_019422742.1 PREDICTED: acyl-CoA-binding protein-like [Lupinus... 59 3e-09 XP_009365752.1 PREDICTED: acyl-CoA-binding protein [Pyrus x bret... 59 3e-09 >XP_016201243.1 PREDICTED: acyl-CoA-binding protein [Arachis ipaensis] Length = 90 Score = 61.2 bits (147), Expect = 3e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAM+DYITKVKQLLEEAGL+A Sbjct: 60 WKAVEGKSKEEAMNDYITKVKQLLEEAGLTA 90 >XP_015963178.1 PREDICTED: acyl-CoA-binding protein [Arachis duranensis] Length = 90 Score = 60.5 bits (145), Expect = 5e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAM+DYITKVKQLLEEAGL A Sbjct: 60 WKAVEGKSKEEAMNDYITKVKQLLEEAGLPA 90 >KQL09024.1 hypothetical protein SETIT_007643mg [Setaria italica] Length = 82 Score = 60.1 bits (144), Expect = 6e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAMSDYITKVKQLLEEAG S Sbjct: 51 WKAVEGKSKEEAMSDYITKVKQLLEEAGAS 80 >KQL09025.1 hypothetical protein SETIT_007643mg [Setaria italica] Length = 90 Score = 60.1 bits (144), Expect = 7e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAMSDYITKVKQLLEEAG S Sbjct: 59 WKAVEGKSKEEAMSDYITKVKQLLEEAGAS 88 >XP_006432817.1 hypothetical protein CICLE_v10002973mg [Citrus clementina] XP_006471567.1 PREDICTED: acyl-CoA-binding protein [Citrus sinensis] ESR46057.1 hypothetical protein CICLE_v10002973mg [Citrus clementina] Length = 90 Score = 60.1 bits (144), Expect = 7e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQL EEAG+SA Sbjct: 60 WKAVEGKSKEEAMSDYITKVKQLQEEAGVSA 90 >XP_004512378.1 PREDICTED: acyl-CoA-binding protein isoform X3 [Cicer arietinum] XP_004512379.1 PREDICTED: acyl-CoA-binding protein isoform X4 [Cicer arietinum] Length = 90 Score = 60.1 bits (144), Expect = 7e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQLLEEAG+ A Sbjct: 60 WKAVEGKSKEEAMSDYITKVKQLLEEAGVLA 90 >XP_004964355.1 PREDICTED: acyl-CoA-binding protein [Setaria italica] KQL09026.1 hypothetical protein SETIT_007643mg [Setaria italica] Length = 91 Score = 60.1 bits (144), Expect = 8e-10 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAMSDYITKVKQLLEEAG S Sbjct: 60 WKAVEGKSKEEAMSDYITKVKQLLEEAGAS 89 >OIW10729.1 hypothetical protein TanjilG_27675 [Lupinus angustifolius] Length = 57 Score = 58.9 bits (141), Expect = 9e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAM+DYITKVKQLLEEAG++ Sbjct: 27 WKAVEGKSKEEAMNDYITKVKQLLEEAGIA 56 >XP_004512377.1 PREDICTED: acyl-CoA-binding protein isoform X1 [Cicer arietinum] XP_012574576.1 PREDICTED: acyl-CoA-binding protein isoform X2 [Cicer arietinum] Length = 104 Score = 60.1 bits (144), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQLLEEAG+ A Sbjct: 74 WKAVEGKSKEEAMSDYITKVKQLLEEAGVLA 104 >XP_017426560.1 PREDICTED: acyl-CoA-binding protein isoform X1 [Vigna angularis] Length = 90 Score = 59.3 bits (142), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSK+EAM+DYITKVKQLLEEAGL A Sbjct: 60 WKAVEGKSKDEAMNDYITKVKQLLEEAGLPA 90 >XP_017426562.1 PREDICTED: acyl-CoA-binding protein isoform X2 [Vigna angularis] KOM45422.1 hypothetical protein LR48_Vigan06g072800 [Vigna angularis] Length = 90 Score = 59.3 bits (142), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSK+EAM+DYITKVKQLLEEAGL A Sbjct: 60 WKAVEGKSKDEAMNDYITKVKQLLEEAGLPA 90 >XP_002303469.1 acyl-CoA-binding family protein [Populus trichocarpa] EEE78448.1 acyl-CoA-binding family protein [Populus trichocarpa] Length = 90 Score = 59.3 bits (142), Expect = 1e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQLLEEA SA Sbjct: 60 WKAVEGKSKEEAMSDYITKVKQLLEEAAASA 90 >XP_007158140.1 hypothetical protein PHAVU_002G127700g [Phaseolus vulgaris] ESW30134.1 hypothetical protein PHAVU_002G127700g [Phaseolus vulgaris] Length = 90 Score = 59.3 bits (142), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSK+EAM+DYITKVKQLLEEAGL A Sbjct: 60 WKAVEGKSKDEAMNDYITKVKQLLEEAGLPA 90 >BAT99755.1 hypothetical protein VIGAN_10126700 [Vigna angularis var. angularis] Length = 92 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSK+EAM+DYITKVKQLLEEAGL A Sbjct: 62 WKAVEGKSKDEAMNDYITKVKQLLEEAGLPA 92 >XP_002519878.2 PREDICTED: acyl-CoA-binding protein [Ricinus communis] Length = 93 Score = 59.3 bits (142), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQLLEEA SA Sbjct: 63 WKAVEGKSKEEAMSDYITKVKQLLEEAAASA 93 >XP_006385713.1 hypothetical protein POPTR_0003s10270g [Populus trichocarpa] ERP63510.1 hypothetical protein POPTR_0003s10270g [Populus trichocarpa] Length = 95 Score = 59.3 bits (142), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WKAVEGKSKEEAMSDYITKVKQLLEEA SA Sbjct: 65 WKAVEGKSKEEAMSDYITKVKQLLEEAAASA 95 >XP_019445210.1 PREDICTED: acyl-CoA-binding protein-like [Lupinus angustifolius] Length = 90 Score = 58.9 bits (141), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAM+DYITKVKQLLEEAG++ Sbjct: 60 WKAVEGKSKEEAMNDYITKVKQLLEEAGIA 89 >AFK47991.1 unknown [Lotus japonicus] Length = 90 Score = 58.9 bits (141), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLSA 201 WK VEGKSKEEAM+DYITKVKQLLEEAGL+A Sbjct: 60 WKNVEGKSKEEAMNDYITKVKQLLEEAGLAA 90 >XP_019422742.1 PREDICTED: acyl-CoA-binding protein-like [Lupinus angustifolius] Length = 90 Score = 58.5 bits (140), Expect = 3e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAM+DY+TKVKQLLEEAG++ Sbjct: 60 WKAVEGKSKEEAMNDYVTKVKQLLEEAGIA 89 >XP_009365752.1 PREDICTED: acyl-CoA-binding protein [Pyrus x bretschneideri] XP_009343191.1 PREDICTED: acyl-CoA-binding protein [Pyrus x bretschneideri] Length = 90 Score = 58.5 bits (140), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 293 WKAVEGKSKEEAMSDYITKVKQLLEEAGLS 204 WKAVEGKSKEEAM DYITKVKQLLEEAG S Sbjct: 60 WKAVEGKSKEEAMGDYITKVKQLLEEAGAS 89