BLASTX nr result
ID: Glycyrrhiza36_contig00011002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00011002 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016187632.1 PREDICTED: rhodanese-like domain-containing prote... 59 2e-08 XP_015954529.1 PREDICTED: rhodanese-like domain-containing prote... 59 2e-08 XP_019415813.1 PREDICTED: rhodanese-like domain-containing prote... 55 4e-07 OIV98184.1 hypothetical protein TanjilG_11581 [Lupinus angustifo... 55 4e-07 KHN07972.1 hypothetical protein glysoja_039846 [Glycine soja] 55 8e-07 XP_003526989.1 PREDICTED: rhodanese-like domain-containing prote... 55 8e-07 AFK41486.1 unknown [Lotus japonicus] 54 1e-06 XP_013460987.1 rhodanese/cell cycle control phosphatase superfam... 53 3e-06 KYP69599.1 hypothetical protein KK1_008796 [Cajanus cajan] 52 5e-06 XP_007137992.1 hypothetical protein PHAVU_009G171900g [Phaseolus... 52 5e-06 XP_004501853.1 PREDICTED: rhodanese-like domain-containing prote... 52 7e-06 >XP_016187632.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Arachis ipaensis] Length = 292 Score = 58.9 bits (141), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 I DGK++VLTPR+AG AVQLSN PF DV PSNEHN Sbjct: 83 IRDGKVKVLTPREAGYAVQLSNKPFLDVRPSNEHN 117 >XP_015954529.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Arachis duranensis] Length = 292 Score = 58.9 bits (141), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 I DGK++VLTPR+AG AVQLSN PF DV PSNEHN Sbjct: 83 IRDGKVKVLTPREAGYAVQLSNKPFLDVRPSNEHN 117 >XP_019415813.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Lupinus angustifolius] Length = 288 Score = 55.5 bits (132), Expect = 4e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 I DGK++VLTP++AG AVQLSN P DV PSNEHN Sbjct: 79 IRDGKVKVLTPKEAGYAVQLSNKPLLDVRPSNEHN 113 >OIV98184.1 hypothetical protein TanjilG_11581 [Lupinus angustifolius] Length = 307 Score = 55.5 bits (132), Expect = 4e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 I DGK++VLTP++AG AVQLSN P DV PSNEHN Sbjct: 79 IRDGKVKVLTPKEAGYAVQLSNKPLLDVRPSNEHN 113 >KHN07972.1 hypothetical protein glysoja_039846 [Glycine soja] Length = 290 Score = 54.7 bits (130), Expect = 8e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEH 125 I DGKI+VLTPR+AG AVQLSN P DV PSNEH Sbjct: 81 IRDGKIKVLTPREAGYAVQLSNKPLLDVRPSNEH 114 >XP_003526989.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Glycine max] KRH54289.1 hypothetical protein GLYMA_06G175800 [Glycine max] Length = 290 Score = 54.7 bits (130), Expect = 8e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEH 125 I DGKI+VLTPR+AG AVQLSN P DV PSNEH Sbjct: 81 IRDGKIKVLTPREAGYAVQLSNKPLLDVRPSNEH 114 >AFK41486.1 unknown [Lotus japonicus] Length = 287 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEH 125 I DGK++VLTPR+AG AVQLSN P DV PSNEH Sbjct: 78 IRDGKVKVLTPREAGYAVQLSNKPLLDVRPSNEH 111 >XP_013460987.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] KEH35021.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 290 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 + D KI+VLTPR+AG AVQLSN P DV PSNEHN Sbjct: 81 LRDEKIKVLTPREAGYAVQLSNKPLLDVRPSNEHN 115 >KYP69599.1 hypothetical protein KK1_008796 [Cajanus cajan] Length = 282 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEH 125 I DGK++VLTPR+AG AVQLS+ P DV PSNEH Sbjct: 79 IRDGKVKVLTPREAGYAVQLSSKPLLDVRPSNEH 112 >XP_007137992.1 hypothetical protein PHAVU_009G171900g [Phaseolus vulgaris] ESW09986.1 hypothetical protein PHAVU_009G171900g [Phaseolus vulgaris] Length = 287 Score = 52.4 bits (124), Expect = 5e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEH 125 I DGK++VLTPR+AG AVQLS+ P DV PSNEH Sbjct: 78 IRDGKVKVLTPREAGYAVQLSSKPLLDVRPSNEH 111 >XP_004501853.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Cicer arietinum] Length = 292 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 24 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 128 I D KI+VLTPR+AG AVQLSN P DV PSNEH+ Sbjct: 83 IRDEKIKVLTPREAGYAVQLSNKPLIDVRPSNEHS 117