BLASTX nr result
ID: Glycyrrhiza36_contig00010931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00010931 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019458433.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 65 5e-10 XP_019448106.1 PREDICTED: plastidic ATP/ADP-transporter-like [Lu... 59 5e-08 KYP54005.1 Plastidic ATP/ADP-transporter [Cajanus cajan] 57 3e-07 XP_016175729.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 57 3e-07 XP_015938142.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 56 8e-07 KHN01355.1 ADP,ATP carrier protein 1, chloroplastic [Glycine soja] 55 1e-06 XP_006583133.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 55 1e-06 XP_019443401.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 55 2e-06 XP_011039999.1 PREDICTED: plastidic ATP/ADP-transporter-like [Po... 55 2e-06 XP_002303268.1 Chloroplast ADP family protein [Populus trichocar... 55 2e-06 XP_019425134.1 PREDICTED: plastidic ATP/ADP-transporter-like [Lu... 54 4e-06 XP_003546196.1 PREDICTED: ADP,ATP carrier protein 1, chloroplast... 54 5e-06 XP_004506888.1 PREDICTED: plastidic ATP/ADP-transporter-like [Ci... 54 5e-06 XP_002298119.2 Chloroplast ADP family protein [Populus trichocar... 53 7e-06 >XP_019458433.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Lupinus angustifolius] XP_019458434.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Lupinus angustifolius] OIW03841.1 hypothetical protein TanjilG_30117 [Lupinus angustifolius] Length = 621 Score = 65.1 bits (157), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 MEAVLQTRGLLSLP+NPRNRVLHPSHGLK RF Sbjct: 1 MEAVLQTRGLLSLPSNPRNRVLHPSHGLKHRF 32 >XP_019448106.1 PREDICTED: plastidic ATP/ADP-transporter-like [Lupinus angustifolius] OIW09078.1 hypothetical protein TanjilG_16305 [Lupinus angustifolius] Length = 621 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 M+AVLQTRGLLSLPT PRN V HPSHGLK RF Sbjct: 1 MDAVLQTRGLLSLPTKPRNTVFHPSHGLKHRF 32 >KYP54005.1 Plastidic ATP/ADP-transporter [Cajanus cajan] Length = 616 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 M+AV+QTRGLLSLPTNPRNRVLH H LK RF Sbjct: 1 MDAVVQTRGLLSLPTNPRNRVLHAPHALKHRF 32 >XP_016175729.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Arachis ipaensis] Length = 633 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 MEAVLQ+RGLLSLPTNPRNR LH S GLK RF Sbjct: 1 MEAVLQSRGLLSLPTNPRNRFLHSSQGLKHRF 32 >XP_015938142.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Arachis duranensis] Length = 633 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 MEAVLQ+RGLLSLPTNPRNR LH + GLK RF Sbjct: 1 MEAVLQSRGLLSLPTNPRNRFLHSTQGLKHRF 32 >KHN01355.1 ADP,ATP carrier protein 1, chloroplastic [Glycine soja] Length = 623 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRV---LHPSHGLKQRF 3 M+AV+QTRGLLSLPTNP+ RV LHPSHGLK RF Sbjct: 1 MDAVVQTRGLLSLPTNPKTRVSHHLHPSHGLKHRF 35 >XP_006583133.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Glycine max] KRH47502.1 hypothetical protein GLYMA_07G033100 [Glycine max] Length = 623 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRV---LHPSHGLKQRF 3 M+AV+QTRGLLSLPTNP+ RV LHPSHGLK RF Sbjct: 1 MDAVVQTRGLLSLPTNPKTRVSHHLHPSHGLKHRF 35 >XP_019443401.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Lupinus angustifolius] OIW11913.1 hypothetical protein TanjilG_18186 [Lupinus angustifolius] Length = 621 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 MEAVLQT+GLLSLP NPR R L PSHGLK RF Sbjct: 1 MEAVLQTKGLLSLPLNPRIRALQPSHGLKHRF 32 >XP_011039999.1 PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica] Length = 623 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQR 6 MEAVLQTRGLLSLP NP+ RVL+PS GLKQR Sbjct: 1 MEAVLQTRGLLSLPPNPKGRVLYPSQGLKQR 31 >XP_002303268.1 Chloroplast ADP family protein [Populus trichocarpa] EEE78247.1 Chloroplast ADP family protein [Populus trichocarpa] Length = 623 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQR 6 MEAVLQTRGLLSLP NP+ RVL+PS GLKQR Sbjct: 1 MEAVLQTRGLLSLPPNPKGRVLYPSQGLKQR 31 >XP_019425134.1 PREDICTED: plastidic ATP/ADP-transporter-like [Lupinus angustifolius] OIW17125.1 hypothetical protein TanjilG_27279 [Lupinus angustifolius] Length = 602 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 MEAV Q +G LSLPTNPR R LHPS GLKQRF Sbjct: 1 MEAVFQIKGFLSLPTNPRIRALHPSQGLKQRF 32 >XP_003546196.1 PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine max] KRH09791.1 hypothetical protein GLYMA_15G011500 [Glycine max] Length = 617 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRV--LHPSHGLKQR 6 M+AVLQTRGLLSLPTNP NR+ LHPSHGL+ R Sbjct: 1 MDAVLQTRGLLSLPTNPINRISLLHPSHGLRHR 33 >XP_004506888.1 PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum] Length = 618 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQRF 3 M+AVLQTRGLLSLPTNP+NRV H + LKQRF Sbjct: 1 MDAVLQTRGLLSLPTNPKNRVFHQPNCLKQRF 32 >XP_002298119.2 Chloroplast ADP family protein [Populus trichocarpa] EEE82924.2 Chloroplast ADP family protein [Populus trichocarpa] Length = 621 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 98 MEAVLQTRGLLSLPTNPRNRVLHPSHGLKQR 6 MEAVLQT+GLLSLP+NP+ R L+PS GLKQR Sbjct: 1 MEAVLQTKGLLSLPSNPKTRALYPSQGLKQR 31