BLASTX nr result
ID: Glycyrrhiza36_contig00010929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00010929 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014493411.1 PREDICTED: uncharacterized protein LOC106755717 [... 59 1e-09 XP_017432824.1 PREDICTED: uncharacterized protein LOC108340109 [... 59 1e-09 KRH20797.1 hypothetical protein GLYMA_13G201100 [Glycine max] 58 2e-09 KHN37636.1 hypothetical protein glysoja_007339 [Glycine soja] 58 3e-09 KRH20796.1 hypothetical protein GLYMA_13G201100 [Glycine max] 58 3e-09 NP_001236665.1 uncharacterized protein LOC100500603 precursor [G... 58 3e-09 GAU36221.1 hypothetical protein TSUD_363760 [Trifolium subterran... 57 6e-09 KRH27442.1 hypothetical protein GLYMA_12G235600 [Glycine max] 58 7e-09 KHN19468.1 hypothetical protein glysoja_026083 [Glycine soja] 58 7e-09 XP_004511001.1 PREDICTED: uncharacterized protein LOC101504121 [... 56 2e-08 KYP41697.1 hypothetical protein KK1_036911, partial [Cajanus cajan] 55 3e-08 XP_003627749.1 transmembrane protein, putative [Medicago truncat... 55 6e-08 XP_007133799.1 hypothetical protein PHAVU_011G210100g [Phaseolus... 53 4e-07 >XP_014493411.1 PREDICTED: uncharacterized protein LOC106755717 [Vigna radiata var. radiata] Length = 92 Score = 59.3 bits (142), Expect = 1e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVRSIHERLLRANT+DYGRYD Sbjct: 48 TPRKALNKEEVRSIHERLLRANTKDYGRYD 77 >XP_017432824.1 PREDICTED: uncharacterized protein LOC108340109 [Vigna angularis] KOM49268.1 hypothetical protein LR48_Vigan08g009500 [Vigna angularis] BAT89231.1 hypothetical protein VIGAN_06013100 [Vigna angularis var. angularis] Length = 92 Score = 59.3 bits (142), Expect = 1e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVRSIHERLLRANT+DYGRYD Sbjct: 48 TPRKALNKEEVRSIHERLLRANTKDYGRYD 77 >KRH20797.1 hypothetical protein GLYMA_13G201100 [Glycine max] Length = 67 Score = 58.2 bits (139), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 23 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 52 >KHN37636.1 hypothetical protein glysoja_007339 [Glycine soja] Length = 89 Score = 58.2 bits (139), Expect = 3e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 45 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 74 >KRH20796.1 hypothetical protein GLYMA_13G201100 [Glycine max] Length = 93 Score = 58.2 bits (139), Expect = 3e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 49 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 78 >NP_001236665.1 uncharacterized protein LOC100500603 precursor [Glycine max] ACU15729.1 unknown [Glycine max] Length = 93 Score = 58.2 bits (139), Expect = 3e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 49 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 78 >GAU36221.1 hypothetical protein TSUD_363760 [Trifolium subterraneum] Length = 91 Score = 57.4 bits (137), Expect = 6e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 24 VTPRKELNDEEVRSIHERLLRANTRDYGRYD 116 VT R+E+N+EEV SIHERLLRANT+DYGRYD Sbjct: 46 VTTRREMNEEEVNSIHERLLRANTKDYGRYD 76 >KRH27442.1 hypothetical protein GLYMA_12G235600 [Glycine max] Length = 130 Score = 58.2 bits (139), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 86 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 115 >KHN19468.1 hypothetical protein glysoja_026083 [Glycine soja] Length = 135 Score = 58.2 bits (139), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 TPRK LN EEVR+IHERLLRANT+DYGRYD Sbjct: 91 TPRKPLNKEEVRTIHERLLRANTKDYGRYD 120 >XP_004511001.1 PREDICTED: uncharacterized protein LOC101504121 [Cicer arietinum] Length = 91 Score = 55.8 bits (133), Expect = 2e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 21 RVTPRKELNDEEVRSIHERLLRANTRDYGRYD 116 +VT R E+N+EEV +IHERLLRANT+DYGRYD Sbjct: 45 KVTTRNEMNEEEVSNIHERLLRANTKDYGRYD 76 >KYP41697.1 hypothetical protein KK1_036911, partial [Cajanus cajan] Length = 63 Score = 54.7 bits (130), Expect = 3e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 IQDEGIRVTPRKELNDEEVRSIHERLLRANTRDYGRYD 116 IQ+E TPRK +N EEVR+I+ERLLRANT+DYGRYD Sbjct: 15 IQEE----TPRKPVNKEEVRTINERLLRANTKDYGRYD 48 >XP_003627749.1 transmembrane protein, putative [Medicago truncatula] AET02225.1 transmembrane protein, putative [Medicago truncatula] AFK34173.1 unknown [Medicago truncatula] Length = 91 Score = 54.7 bits (130), Expect = 6e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 24 VTPRKELNDEEVRSIHERLLRANTRDYGRYD 116 VT + +N+EEVRSIHERLLRANT+DYGRYD Sbjct: 46 VTTKMAMNEEEVRSIHERLLRANTKDYGRYD 76 >XP_007133799.1 hypothetical protein PHAVU_011G210100g [Phaseolus vulgaris] ESW05793.1 hypothetical protein PHAVU_011G210100g [Phaseolus vulgaris] Length = 92 Score = 52.8 bits (125), Expect = 4e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 27 TPRKELNDEEVRSIHERLLRANTRDYGRYD 116 T RK LN EEV SIHER+LRANT+DYGRYD Sbjct: 48 TSRKALNKEEVSSIHERVLRANTKDYGRYD 77