BLASTX nr result
ID: Glycyrrhiza36_contig00010670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00010670 (669 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK48113.1 unknown [Medicago truncatula] 70 1e-12 CBI39675.3 unnamed protein product, partial [Vitis vinifera] 68 3e-11 XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [... 67 7e-10 AAF26091.1 low temperature and salt responsive protein LTI6B [Ar... 58 6e-08 XP_002884539.1 low temperature and salt responsive protein LTI6B... 57 9e-08 XP_003626135.2 low temperature and salt responsive family protei... 57 9e-08 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 57 1e-07 XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus ... 57 1e-07 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 56 2e-07 KMZ61773.1 Low temperature and salt responsive protein [Zostera ... 56 2e-07 XP_008370336.1 PREDICTED: hydrophobic protein RCI2A-like [Malus ... 56 3e-07 XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria ve... 56 3e-07 XP_007207409.1 hypothetical protein PRUPE_ppa014548mg [Prunus pe... 56 3e-07 KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] 55 4e-07 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 55 5e-07 XP_008246326.1 PREDICTED: hydrophobic protein LTI6B-like [Prunus... 55 5e-07 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 55 7e-07 XP_018463798.1 PREDICTED: hydrophobic protein RCI2B-like [Raphan... 55 7e-07 XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium r... 55 7e-07 XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossyp... 55 7e-07 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 70.1 bits (170), Expect = 1e-12 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +2 Query: 212 STWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLIN 349 S+ CLPQVWLP GVL LFG +PFW+ WN LCYLC++QVI L ++ Sbjct: 12 SSRCLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVINLAFVD 57 >CBI39675.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 68.2 bits (165), Expect = 3e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +2 Query: 218 WCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 331 WCLPQVW+P GVLDLFGA F + SWN LC LCHHQVI Sbjct: 60 WCLPQVWMPGGVLDLFGADFFRLPSWNCLCCLCHHQVI 97 >XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 66.6 bits (161), Expect = 7e-10 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +2 Query: 212 STWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLINFASVDNE*LYV 382 S+W LPQVWLP G+LDLF A W++ W++LC+LCHHQV + NF D + YV Sbjct: 137 SSWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQV----MSNFCIRDAKDTYV 189 >AAF26091.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 57.8 bits (138), Expect = 6e-08 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLFXXXXXXXXXXXXXTK*SNCP*LISLLW 362 PPLGVFLKFGC VEFWICL+LTLF TK ++C ++ LW Sbjct: 16 PPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKNSCFVVLFSLW 66 >XP_002884539.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] EFH60798.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 57.4 bits (137), Expect = 9e-08 Identities = 27/51 (52%), Positives = 31/51 (60%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLFXXXXXXXXXXXXXTK*SNCP*LISLLW 362 PPLGVFLKFGC VEFWICL+LTLF TK + C ++ LW Sbjct: 16 PPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKRNRCFVVLFSLW 66 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 57.0 bits (136), Expect = 9e-08 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFW+CLVLTLF Sbjct: 16 PPLGVFLKFGCHVEFWLCLVLTLF 39 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLK+GCHVEFWICLVLTLF Sbjct: 18 PPLGVFLKYGCHVEFWICLVLTLF 41 >XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 56.6 bits (135), Expect = 1e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICL+LTLF Sbjct: 19 PPLGVFLKFGCHVEFWICLLLTLF 42 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICLVLT F Sbjct: 19 PPLGVFLKFGCHVEFWICLVLTFF 42 >KMZ61773.1 Low temperature and salt responsive protein [Zostera marina] Length = 54 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PP+GVFLKFGCHVEFWICL+LTLF Sbjct: 16 PPIGVFLKFGCHVEFWICLLLTLF 39 >XP_008370336.1 PREDICTED: hydrophobic protein RCI2A-like [Malus domestica] Length = 57 Score = 55.8 bits (133), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICL+LT+F Sbjct: 19 PPLGVFLKFGCHVEFWICLLLTIF 42 >XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria vesca subsp. vesca] Length = 57 Score = 55.8 bits (133), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICL+LT+F Sbjct: 19 PPLGVFLKFGCHVEFWICLLLTIF 42 >XP_007207409.1 hypothetical protein PRUPE_ppa014548mg [Prunus persica] ONI04115.1 hypothetical protein PRUPE_6G303700 [Prunus persica] Length = 57 Score = 55.8 bits (133), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICL+LT+F Sbjct: 19 PPLGVFLKFGCHVEFWICLLLTIF 42 >KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] Length = 57 Score = 55.5 bits (132), Expect = 4e-07 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = +2 Query: 251 VLDLFGAHPFWVYSWNHLCYLCHHQVI 331 +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 14 ILDLFGAYPFWLHSWNYLCCLCYHQVI 40 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 55.1 bits (131), Expect = 5e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGC+VEFWICLVLTLF Sbjct: 19 PPLGVFLKFGCNVEFWICLVLTLF 42 >XP_008246326.1 PREDICTED: hydrophobic protein LTI6B-like [Prunus mume] Length = 57 Score = 55.1 bits (131), Expect = 5e-07 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGCHVEFWICL+LT F Sbjct: 19 PPLGVFLKFGCHVEFWICLLLTFF 42 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGC VEFWICLVLTLF Sbjct: 16 PPLGVFLKFGCEVEFWICLVLTLF 39 >XP_018463798.1 PREDICTED: hydrophobic protein RCI2B-like [Raphanus sativus] Length = 55 Score = 54.7 bits (130), Expect = 7e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGC+VEFWICL+LTLF Sbjct: 16 PPLGVFLKFGCNVEFWICLILTLF 39 >XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] XP_016667936.1 PREDICTED: hydrophobic protein RCI2B [Gossypium hirsutum] KJB82717.1 hypothetical protein B456_013G210800 [Gossypium raimondii] KJB82718.1 hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGC VEFWICLVLTLF Sbjct: 19 PPLGVFLKFGCQVEFWICLVLTLF 42 >XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossypium hirsutum] XP_017618304.1 PREDICTED: hydrophobic protein RCI2B [Gossypium arboreum] KHG20782.1 Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +3 Query: 210 PPLGVFLKFGCHVEFWICLVLTLF 281 PPLGVFLKFGC VEFWICLVLTLF Sbjct: 19 PPLGVFLKFGCQVEFWICLVLTLF 42