BLASTX nr result
ID: Glycyrrhiza36_contig00010150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00010150 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004495094.1 PREDICTED: rho-N domain-containing protein 1, chl... 75 5e-14 KYP74172.1 SAP-like protein BP-73 [Cajanus cajan] 74 1e-13 XP_017415680.1 PREDICTED: rho-N domain-containing protein 1, chl... 72 6e-13 XP_017415679.1 PREDICTED: rho-N domain-containing protein 1, chl... 72 6e-13 XP_007144890.1 hypothetical protein PHAVU_007G192400g [Phaseolus... 71 2e-12 XP_003537022.1 PREDICTED: rho-N domain-containing protein 1, chl... 71 2e-12 XP_006593341.1 PREDICTED: uncharacterized protein LOC100305743 i... 69 6e-12 KHN44955.1 SAP-like protein BP-73 [Glycine soja] 69 6e-12 XP_006593340.1 PREDICTED: uncharacterized protein LOC100305743 i... 69 6e-12 OIV90518.1 hypothetical protein TanjilG_32395 [Lupinus angustifo... 69 6e-12 XP_019428872.1 PREDICTED: rho-N domain-containing protein 1, chl... 69 6e-12 KHN03886.1 SAP-like protein BP-73 [Glycine soja] 69 1e-11 XP_013468480.1 Rho termination factor, putative [Medicago trunca... 69 1e-11 XP_014510846.1 PREDICTED: rho-N domain-containing protein 1, chl... 69 1e-11 XP_019461328.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 XP_019430141.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 XP_019461327.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 XP_019430139.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 XP_019430140.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 XP_019430138.1 PREDICTED: rho-N domain-containing protein 1, chl... 68 2e-11 >XP_004495094.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic [Cicer arietinum] Length = 373 Score = 75.1 bits (183), Expect = 5e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE LVVQ+EDLSALKLSELRALAKSRGLKGFSKMKK Sbjct: 323 NDESVEEQLVVQNEDLSALKLSELRALAKSRGLKGFSKMKK 363 >KYP74172.1 SAP-like protein BP-73 [Cajanus cajan] Length = 357 Score = 73.9 bits (180), Expect = 1e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDE+VEE VVQHEDLSALKLSELRALAKSRGLKGFSKMKK Sbjct: 307 NDENVEEQPVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 347 >XP_017415680.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X2 [Vigna angularis] KOM35234.1 hypothetical protein LR48_Vigan02g138400 [Vigna angularis] Length = 356 Score = 72.0 bits (175), Expect = 6e-13 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE VQHEDLSALKLSELR LAKSRGLKGFSKMKK Sbjct: 306 NDESVEEQPAVQHEDLSALKLSELRVLAKSRGLKGFSKMKK 346 >XP_017415679.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic isoform X1 [Vigna angularis] BAT95358.1 hypothetical protein VIGAN_08206600 [Vigna angularis var. angularis] Length = 372 Score = 72.0 bits (175), Expect = 6e-13 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE VQHEDLSALKLSELR LAKSRGLKGFSKMKK Sbjct: 322 NDESVEEQPAVQHEDLSALKLSELRVLAKSRGLKGFSKMKK 362 >XP_007144890.1 hypothetical protein PHAVU_007G192400g [Phaseolus vulgaris] ESW16884.1 hypothetical protein PHAVU_007G192400g [Phaseolus vulgaris] Length = 373 Score = 70.9 bits (172), Expect = 2e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE VQHEDLSALKLSELR +AKSRGLKGFSKMKK Sbjct: 323 NDESVEEQPAVQHEDLSALKLSELRVVAKSRGLKGFSKMKK 363 >XP_003537022.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like [Glycine max] KRH32189.1 hypothetical protein GLYMA_10G037400 [Glycine max] Length = 374 Score = 70.9 bits (172), Expect = 2e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE V QHED SALKLSELRALAK+RGLKGFSKMKK Sbjct: 324 NDESVEEQPVAQHEDFSALKLSELRALAKTRGLKGFSKMKK 364 >XP_006593341.1 PREDICTED: uncharacterized protein LOC100305743 isoform X2 [Glycine max] Length = 369 Score = 69.3 bits (168), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE QH+DLSALKLSELRALAK+RGLKGFSKMKK Sbjct: 319 NDESVEEQPAAQHKDLSALKLSELRALAKTRGLKGFSKMKK 359 >KHN44955.1 SAP-like protein BP-73 [Glycine soja] Length = 372 Score = 69.3 bits (168), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE QH+DLSALKLSELRALAK+RGLKGFSKMKK Sbjct: 322 NDESVEEQPAAQHKDLSALKLSELRALAKTRGLKGFSKMKK 362 >XP_006593340.1 PREDICTED: uncharacterized protein LOC100305743 isoform X1 [Glycine max] KRH19564.1 hypothetical protein GLYMA_13G124000 [Glycine max] Length = 374 Score = 69.3 bits (168), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 NDESVEE QH+DLSALKLSELRALAK+RGLKGFSKMKK Sbjct: 324 NDESVEEQPAAQHKDLSALKLSELRALAKTRGLKGFSKMKK 364 >OIV90518.1 hypothetical protein TanjilG_32395 [Lupinus angustifolius] Length = 380 Score = 69.3 bits (168), Expect = 6e-12 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +2 Query: 2 NDESVEEP-LVVQHEDLSALKLSELRALAKSRGLKGFSKMKKG 127 NDE EE LVVQHEDLSALKL ELRA+AKSRGLKGFSKMKKG Sbjct: 329 NDEHAEEEELVVQHEDLSALKLPELRAIAKSRGLKGFSKMKKG 371 >XP_019428872.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like [Lupinus angustifolius] Length = 392 Score = 69.3 bits (168), Expect = 6e-12 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +2 Query: 2 NDESVEEP-LVVQHEDLSALKLSELRALAKSRGLKGFSKMKKG 127 NDE EE LVVQHEDLSALKL ELRA+AKSRGLKGFSKMKKG Sbjct: 341 NDEHAEEEELVVQHEDLSALKLPELRAIAKSRGLKGFSKMKKG 383 >KHN03886.1 SAP-like protein BP-73 [Glycine soja] Length = 358 Score = 68.6 bits (166), Expect = 1e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 DESVEE V QHED SALKLSELRALAK+RGLKGFSKMKK Sbjct: 309 DESVEEQPVAQHEDFSALKLSELRALAKTRGLKGFSKMKK 348 >XP_013468480.1 Rho termination factor, putative [Medicago truncatula] KEH42517.1 Rho termination factor, putative [Medicago truncatula] Length = 371 Score = 68.6 bits (166), Expect = 1e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKKG 127 N+E V+E +VVQ+EDL+ALK+SELRALAKSRG+KGFSKMKKG Sbjct: 321 NNEGVDEHVVVQNEDLNALKMSELRALAKSRGMKGFSKMKKG 362 >XP_014510846.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic [Vigna radiata var. radiata] Length = 372 Score = 68.6 bits (166), Expect = 1e-11 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = +2 Query: 2 NDESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 N ESVEE VQHEDLSALKLSELR LAKSRGLKGFSKMKK Sbjct: 322 NYESVEEQPAVQHEDLSALKLSELRVLAKSRGLKGFSKMKK 362 >XP_019461328.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X2 [Lupinus angustifolius] OIW01701.1 hypothetical protein TanjilG_01208 [Lupinus angustifolius] Length = 382 Score = 67.8 bits (164), Expect = 2e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 +E EE LVVQ+EDLSALKLSELRALAKSRGLKGFSKMKK Sbjct: 333 EEHAEEQLVVQNEDLSALKLSELRALAKSRGLKGFSKMKK 372 >XP_019430141.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X5 [Lupinus angustifolius] Length = 396 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 + +VEE LVVQHEDLSALKL ELR+LAKSRGLKGFSKMKK Sbjct: 347 EHAVEEELVVQHEDLSALKLPELRSLAKSRGLKGFSKMKK 386 >XP_019461327.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X1 [Lupinus angustifolius] Length = 398 Score = 67.8 bits (164), Expect = 2e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 +E EE LVVQ+EDLSALKLSELRALAKSRGLKGFSKMKK Sbjct: 349 EEHAEEQLVVQNEDLSALKLSELRALAKSRGLKGFSKMKK 388 >XP_019430139.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X3 [Lupinus angustifolius] Length = 434 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 + +VEE LVVQHEDLSALKL ELR+LAKSRGLKGFSKMKK Sbjct: 385 EHAVEEELVVQHEDLSALKLPELRSLAKSRGLKGFSKMKK 424 >XP_019430140.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X4 [Lupinus angustifolius] Length = 434 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 + +VEE LVVQHEDLSALKL ELR+LAKSRGLKGFSKMKK Sbjct: 385 EHAVEEELVVQHEDLSALKLPELRSLAKSRGLKGFSKMKK 424 >XP_019430138.1 PREDICTED: rho-N domain-containing protein 1, chloroplastic-like isoform X2 [Lupinus angustifolius] OIW19960.1 hypothetical protein TanjilG_30908 [Lupinus angustifolius] Length = 452 Score = 67.8 bits (164), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 5 DESVEEPLVVQHEDLSALKLSELRALAKSRGLKGFSKMKK 124 + +VEE LVVQHEDLSALKL ELR+LAKSRGLKGFSKMKK Sbjct: 403 EHAVEEELVVQHEDLSALKLPELRSLAKSRGLKGFSKMKK 442