BLASTX nr result
ID: Glycyrrhiza36_contig00009761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00009761 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU29594.1 hypothetical protein TSUD_164420 [Trifolium subterran... 57 6e-07 >GAU29594.1 hypothetical protein TSUD_164420 [Trifolium subterraneum] Length = 758 Score = 56.6 bits (135), Expect = 6e-07 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -2 Query: 350 SADGDDNYSATARSLTETPDSYLTVHSSTDLGKDQSTADTVSSNDQNIFP 201 S +GDD S+TAR+LTE PDS LT +S TDLGKD+S D+ SS D+N P Sbjct: 707 SQNGDDE-SSTARTLTENPDSNLTDNSITDLGKDKSFLDSYSSKDKNTLP 755