BLASTX nr result
ID: Glycyrrhiza36_contig00009684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00009684 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014519200.1 PREDICTED: phosphoserine aminotransferase 1, chlo... 52 8e-06 KOM45230.1 hypothetical protein LR48_Vigan06g053600 [Vigna angul... 52 8e-06 XP_017425896.1 PREDICTED: phosphoserine aminotransferase 1, chlo... 52 9e-06 >XP_014519200.1 PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Vigna radiata var. radiata] Length = 411 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 MSHRGKDFLSIIQKAESDLRTLLENPP*ASV 95 MSHRGK+FLSIIQKAESDLRTLL+ PP SV Sbjct: 89 MSHRGKEFLSIIQKAESDLRTLLQIPPEYSV 119 >KOM45230.1 hypothetical protein LR48_Vigan06g053600 [Vigna angularis] BAT99894.1 hypothetical protein VIGAN_10143600 [Vigna angularis var. angularis] Length = 411 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 MSHRGKDFLSIIQKAESDLRTLLENPP*ASV 95 MSHRGK+FLSIIQKAESDLRTLL+ PP SV Sbjct: 89 MSHRGKEFLSIIQKAESDLRTLLQIPPEYSV 119 >XP_017425896.1 PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like [Vigna angularis] Length = 454 Score = 52.0 bits (123), Expect = 9e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 MSHRGKDFLSIIQKAESDLRTLLENPP*ASV 95 MSHRGK+FLSIIQKAESDLRTLL+ PP SV Sbjct: 132 MSHRGKEFLSIIQKAESDLRTLLQIPPEYSV 162