BLASTX nr result
ID: Glycyrrhiza36_contig00008095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00008095 (423 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAA06493.1 Ubiquitin conjugating enzyme, partial [Cicer arietinum] 62 3e-10 KJU81251.1 hypothetical protein N619_00100, partial [Pseudomonas... 62 4e-10 XP_018468620.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa... 64 5e-10 KRG97124.1 hypothetical protein GLYMA_19G2530001, partial [Glyci... 62 6e-10 EPS68461.1 ubiquitin carrier protein, partial [Genlisea aurea] 62 6e-10 CAJ38381.1 ubiquitin-conjugating enzyme, partial [Plantago major] 62 6e-10 XP_014513977.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 63 6e-10 CEG03292.1 unnamed protein product [Fusarium acuminatum CS5907] 61 6e-10 KJB39132.1 hypothetical protein B456_007G025200 [Gossypium raimo... 63 7e-10 XP_014513976.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 63 8e-10 XP_018841239.1 PREDICTED: ubiquitin-conjugating enzyme E2 11-lik... 61 9e-10 XP_019433059.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 63 9e-10 XP_019462151.1 PREDICTED: ubiquitin-conjugating enzyme E2 5B-lik... 63 9e-10 XP_019460768.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 63 9e-10 XP_003589256.1 ubiquitin-conjugating enzyme E2 [Medicago truncat... 63 9e-10 XP_014513975.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 63 9e-10 XP_007145490.1 hypothetical protein PHAVU_007G243500g [Phaseolus... 63 9e-10 NP_001237609.1 uncharacterized protein LOC100500665 [Glycine max... 63 9e-10 BAF06555.1 Os01g0819500, partial [Oryza sativa Japonica Group] B... 60 1e-09 XP_006385788.1 hypothetical protein POPTR_0003s13600g [Populus t... 62 1e-09 >CAA06493.1 Ubiquitin conjugating enzyme, partial [Cicer arietinum] Length = 61 Score = 61.6 bits (148), Expect = 3e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 12 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 43 >KJU81251.1 hypothetical protein N619_00100, partial [Pseudomonas pseudoalcaligenes] Length = 66 Score = 61.6 bits (148), Expect = 4e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 17 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 48 >XP_018468620.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Raphanus sativus] Length = 147 Score = 63.5 bits (153), Expect = 5e-10 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = +2 Query: 266 KVYHLLVQFMAYFWVQ------ERAVLSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 KVYH + W+ A++S + LSIC+LLTDPNPDDPLVP+IAH+YKTD Sbjct: 72 KVYHPNIDSDGNIWIDILREQWGGALISKVLLSICALLTDPNPDDPLVPEIAHIYKTD 129 >KRG97124.1 hypothetical protein GLYMA_19G2530001, partial [Glycine max] Length = 82 Score = 61.6 bits (148), Expect = 6e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 33 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 64 >EPS68461.1 ubiquitin carrier protein, partial [Genlisea aurea] Length = 82 Score = 61.6 bits (148), Expect = 6e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 33 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 64 >CAJ38381.1 ubiquitin-conjugating enzyme, partial [Plantago major] Length = 82 Score = 61.6 bits (148), Expect = 6e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 33 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 64 >XP_014513977.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform X3 [Vigna radiata var. radiata] Length = 128 Score = 62.8 bits (151), Expect = 6e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 79 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 110 >CEG03292.1 unnamed protein product [Fusarium acuminatum CS5907] Length = 59 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 305 WVQERAVLSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 W++ + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 4 WIKVLTSDFQVLLSICSLLTDPNPDDPLVPEIAHMYKTD 42 >KJB39132.1 hypothetical protein B456_007G025200 [Gossypium raimondii] Length = 153 Score = 63.2 bits (152), Expect = 7e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 317 RAVLSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 + ++ ++ LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 101 KVIVQHVLLSICSLLTDPNPDDPLVPEIAHMYKTD 135 >XP_014513976.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform X2 [Vigna radiata var. radiata] Length = 142 Score = 62.8 bits (151), Expect = 8e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 93 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 124 >XP_018841239.1 PREDICTED: ubiquitin-conjugating enzyme E2 11-like [Juglans regia] XP_018859514.1 PREDICTED: ubiquitin-conjugating enzyme E2 11-like [Juglans regia] Length = 86 Score = 61.2 bits (147), Expect = 9e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 37 VSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 68 >XP_019433059.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Lupinus angustifolius] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >XP_019462151.1 PREDICTED: ubiquitin-conjugating enzyme E2 5B-like [Lupinus angustifolius] XP_019462152.1 PREDICTED: ubiquitin-conjugating enzyme E2 5B-like [Lupinus angustifolius] XP_019462153.1 PREDICTED: ubiquitin-conjugating enzyme E2 5B-like [Lupinus angustifolius] XP_019462154.1 PREDICTED: ubiquitin-conjugating enzyme E2 5B-like [Lupinus angustifolius] OIW01509.1 hypothetical protein TanjilG_19435 [Lupinus angustifolius] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >XP_019460768.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Lupinus angustifolius] XP_019460769.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Lupinus angustifolius] OIW01397.1 hypothetical protein TanjilG_02553 [Lupinus angustifolius] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >XP_003589256.1 ubiquitin-conjugating enzyme E2 [Medicago truncatula] AES59507.1 ubiquitin-conjugating enzyme E2 [Medicago truncatula] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >XP_014513975.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like isoform X1 [Vigna radiata var. radiata] XP_017415748.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Vigna angularis] KOM34307.1 hypothetical protein LR48_Vigan02g045700 [Vigna angularis] BAT96263.1 hypothetical protein VIGAN_08317600 [Vigna angularis var. angularis] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >XP_007145490.1 hypothetical protein PHAVU_007G243500g [Phaseolus vulgaris] ESW17484.1 hypothetical protein PHAVU_007G243500g [Phaseolus vulgaris] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >NP_001237609.1 uncharacterized protein LOC100500665 [Glycine max] ACU15806.1 unknown [Glycine max] KHN35239.1 Ubiquitin-conjugating enzyme E2-17 kDa [Glycine soja] KRH33057.1 hypothetical protein GLYMA_10G096200 [Glycine max] Length = 148 Score = 62.8 bits (151), Expect = 9e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVPDIAHMYKTD Sbjct: 99 VSKVLLSICSLLTDPNPDDPLVPDIAHMYKTD 130 >BAF06555.1 Os01g0819500, partial [Oryza sativa Japonica Group] BAS74959.1 Os01g0819500, partial [Oryza sativa Japonica Group] Length = 47 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 341 LSICSLLTDPNPDDPLVPDIAHMYKTD 421 LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 3 LSICSLLTDPNPDDPLVPEIAHMYKTD 29 >XP_006385788.1 hypothetical protein POPTR_0003s13600g [Populus trichocarpa] ERP63585.1 hypothetical protein POPTR_0003s13600g [Populus trichocarpa] Length = 107 Score = 61.6 bits (148), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 326 LSYLALSICSLLTDPNPDDPLVPDIAHMYKTD 421 +S + LSICSLLTDPNPDDPLVP+IAHMYKTD Sbjct: 58 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 89